(data stored in ACNUC7421 zone)

EMBL: CP001720.PE109

CP001720.PE109       Location/Qualifiers
FT   CDS_pept        118923..119840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0111"
FT                   /product="dimethyladenosine transferase"
FT                   /note="KEGG: baa:BA_0629 ribosomal RNA adenine dimethylase;
FT                   TIGRFAM: dimethyladenosine transferase; PFAM: ribosomal RNA
FT                   adenine methylase transferase; SMART: ribosomal RNA adenine
FT                   methylase transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61074"
FT                   /db_xref="GOA:C8W2R8"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2R8"
FT                   /inference="protein motif:TFAM:TIGR00755"
FT                   /protein_id="ACV61074.1"
FT                   /translation="MSELSSPSKVFNLFKEFNFHTNKKLGQNFLIDSNIISKIISAADL
FT                   RSEDLVVEIGPGLGVLTQSIADEVSRVLSIEIDRKLQPILEVNLKEYSNTKVIFQDALK
FT                   TDFDRLVYAEAGGKSRSYKVIANLPYYITTPLLMHILESKFNVELIVIMVQREVAERMT
FT                   APPGKKDYGALSVAVQYYTEPEIICRVPKTVFIPAPEVDSTVIRLIKRKLPPVQLKSEK
FT                   LFFNLVRTAFNQRRKTVLNAMQGSNWGLMKEEWKIILEKAGIDPMRRGETFSLQDFAML
FT                   SNCVYETLKELSTVYQEGEQIPLY"
     ttgtcggagt tgtcttcacc gtcgaaggtt tttaacctgt ttaaagagtt taattttcac        60
     actaataaaa aattgggaca gaatttttta atagacagca atattatcag taaaataata       120
     tctgctgcgg atttaagaag tgaggatctg gttgtagaaa tcgggcccgg tctgggtgtt       180
     ttgactcagt ctattgccga tgaagttagc cgggttttgt ctatagaaat tgatcggaaa       240
     ttacagccta ttttagaagt taacttaaag gaatatagca atacaaaggt aatttttcaa       300
     gatgccctga aaacagattt tgaccgtttg gtttatgcag aagcaggtgg caaaagtcgc       360
     agctataaag taatagctaa tttaccttat tatattacta ctcctttatt gatgcatata       420
     ctggaaagta aattcaatgt ggaattgatt gttataatgg tacaacgtga ggtggctgag       480
     agaatgacag ccccaccggg aaaaaaagat tacggggcat taagcgtggc agtgcagtat       540
     tatactgagc ctgagataat ctgtcgtgta cccaaaacag tatttatacc tgcacccgaa       600
     gtagattcta cggtaattag gctaataaaa agaaaattgc cgccggtgca gctgaaaagt       660
     gaaaaactat tctttaattt agtcagaacc gcctttaacc aaagaagaaa gacagtttta       720
     aacgcgatgc aaggatctaa ttggggatta atgaaggaag agtggaaaat tatattggag       780
     aaagcgggta tagacccaat gcgcaggggc gaaacctttt ctttgcagga ttttgccatg       840
     ctttccaatt gtgtatatga gacattgaaa gaattgtcaa cagtatatca ggaaggtgaa       900
     caaattccgt tatattag                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page