(data stored in ACNUC7421 zone)

EMBL: CP001720.PE113

CP001720.PE113       Location/Qualifiers
FT   CDS_pept        122667..123737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0115"
FT                   /product="sporulation integral membrane protein YtvI"
FT                   /note="TIGRFAM: sporulation integral membrane protein YtvI;
FT                   PFAM: protein of unknown function UPF0118; KEGG:
FT                   bar:GBAA4841 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61078"
FT                   /db_xref="GOA:C8W2S2"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="InterPro:IPR014227"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2S2"
FT                   /inference="protein motif:TFAM:TIGR02872"
FT                   /protein_id="ACV61078.1"
FT                   /translation="MIVFYLKNMRFLINLVLLLLTMYGIYYLFRLTYHLTFPFLVGTII
FT                   SLTLEPLIVKLQRNSVPRIYSVLFVVFAIVLLTGLLTMWLVYGLTAEIHTLINEYPAIV
FT                   KALQLKQQFLLERMSHYQNILPEEFIYNLKEYSNKVNDYIVGMISKTIQVVFVLLKTVP
FT                   DKLLIYVIVVMYIFFFSMEWPKYKERLKCSISEDLWKKTSQIVNDTKIGIVGYLKAQLI
FT                   IALISGLIILIGLLLIKSQFVLIITIMCIFASFIPFLGVNIVLVPWAIYSAFFCLESFA
FT                   LELIAIMVTVSVVRHIIEPKILGDKLGIQPIGILVALFIGFELVGFWGLILGPLGLIVF
FT                   NSMVKSGLLGSLLIDK"
     atgattgtgt tctatcttaa gaatatgcgt ttcttgataa atcttgttct attgttgctg        60
     acgatgtacg gtatttacta tctattcagg ctcacatatc atttaacatt tccctttttg       120
     gtagggacaa tcatatcctt gacgcttgaa ccattgattg ttaaattgca aaggaattca       180
     gtgccgcgta tctactcagt gttatttgta gtattcgcca ttgtgctttt gacaggtctc       240
     ttaaccatgt ggcttgttta tggattgaca gcggagattc acacgttgat taatgaatat       300
     cccgctattg taaaagcgct tcaattgaaa caacagtttt tgttggagag aatgtcacat       360
     tatcaaaata tcctgccgga ggagtttatt tataatttaa aagagtattc aaataaggtg       420
     aatgattata ttgtaggcat gatttcaaaa actattcaag ttgtttttgt tttacttaag       480
     actgttccgg ataagctttt gatttatgtt atagttgtta tgtatatatt tttctttagc       540
     atggagtggc ccaagtacaa ggaaaggtta aaatgttcaa tttcagagga tttatggaaa       600
     aaaacttctc agatcgtcaa cgatacaaag ataggtatag ttggttattt aaaggcacag       660
     ctaatcatag ctttaatttc aggattaata attctgatag ggttattgct aattaaatca       720
     cagtttgttt taatcattac gattatgtgt atttttgcta gttttattcc ttttttaggc       780
     gtaaatattg ttttggtgcc ttgggctatc tactcggcat ttttttgttt ggaatctttt       840
     gctctggagt taatagctat aatggtaact gtctctgtag tccggcacat tattgagccg       900
     aaaattctcg gcgataaatt aggaatacag cctattggca ttttggttgc tctgtttatt       960
     ggttttgaat tggttggttt ctggggtctg attttaggcc cgctgggact tatagtgttt      1020
     aattccatgg ttaagtcagg tttgctgggt tcattgctga tagacaaata a               1071
//

If you have problems or comments...

PBIL Back to PBIL home page