(data stored in ACNUC7421 zone)

EMBL: CP001720.PE114

CP001720.PE114       Location/Qualifiers
FT   CDS_pept        complement(123831..124628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0116"
FT                   /product="protein of unknown function DUF169"
FT                   /note="PFAM: protein of unknown function DUF169; KEGG:
FT                   sfu:Sfum_3174 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61079"
FT                   /db_xref="InterPro:IPR003748"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2S3"
FT                   /inference="protein motif:PFAM:PF02596"
FT                   /protein_id="ACV61079.1"
FT                   /translation="MKSKIAEAIGLKTKPVAILLSNAKPEDAMQFKEGRWGCVAAMFTA
FT                   AAMKGKSAVFDRKTYGCPGGGVGLGFGNLYLDFPGGFDYFLSIGNPEFCNTELGKNIVR
FT                   IMQSLKDGEAYKKTPELVKSFVDWLPITEVPAEYVIFKPLSEVKEDETPEVVTFLVTAD
FT                   QLSAMVVLANYDRKGSENVMIPFAAGCHNFFLVPYNEGKSDLPRAVVGMTDISVRKHMP
FT                   KDMLSFAMPYKRFLEMEDNVEGSFLQRHCWLEVLPRNNSGDEK"
     gtgaagtcta aaattgctga agctattggt ttaaaaacca aacccgtagc catattactc        60
     agtaacgcaa aaccagaaga tgccatgcaa ttcaaggagg gtcgctgggg ctgtgtggca       120
     gcaatgttta cagccgctgc catgaaaggc aaatcagcgg tatttgacag aaaaacctat       180
     ggttgccccg gcggtggggt aggtttaggc tttggtaacc tctaccttga ttttcctggt       240
     ggttttgact atttcctctc tattggcaac cctgagttct gcaataccga actgggcaaa       300
     aatatagtta gaatcatgca atccttaaaa gacggggaag cctataaaaa gacacctgaa       360
     ctggtaaaat catttgttga ctggctgcca ataacggaag tgccggcaga atatgttatc       420
     tttaagccgc tttcggaagt aaaagaggat gagacacctg aagtagtaac atttctggtc       480
     acagccgacc agctctccgc catggttgta ctggccaact atgaccgtaa aggcagcgag       540
     aacgtaatga ttcccttcgc agcaggatgc cacaattttt tccttgttcc ctacaatgaa       600
     ggcaaatctg atctgccaag agcagtagtc ggcatgacgg atatctctgt acgcaagcac       660
     atgcccaaag atatgctgtc ctttgccatg ccttataaga gattcctgga aatggaagat       720
     aatgtagaag ggagcttcct gcagcggcat tgctggctgg aggtattacc tagaaataat       780
     agcggcgatg aaaaatag                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page