(data stored in ACNUC7421 zone)

EMBL: CP001720.PE116

CP001720.PE116       Location/Qualifiers
FT   CDS_pept        complement(125103..125906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0118"
FT                   /product="CoA-substrate-specific enzyme activase"
FT                   /EC_number="1.3.7.8"
FT                   /note="KEGG: dal:Dalk_3067 CoA-substrate-specific enzyme
FT                   activase; TIGRFAM: CoA-substrate-specific enzyme activase;
FT                   PFAM: ATPase BadF/BadG/BcrA/BcrD type"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61081"
FT                   /db_xref="GOA:C8W2S5"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR008275"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2S5"
FT                   /inference="protein motif:TFAM:TIGR00241"
FT                   /protein_id="ACV61081.1"
FT                   /translation="MINIGIDIGSRTIGMVVLQQDQVVLTNLLNTGFTPLKTAGEMLAS
FT                   VHRALQDFEIKTGFPASPDETTPNSVQITATGYGRHAAKAEFAQRVITEIKAHAIGVTN
FT                   LFPQAKTILDIGGQDTKVIQLDSKGNVTDFQMNDKCSAGTGKFLEVMAAALGYNSPEDF
FT                   GQDALQGKPGIKISNMCTVFAESEAISLLHGGYTRRDIASALHSSTAEKAASMLQRVGL
FT                   EPPVAFTGGVALNPCIVKMLGEMLQTTLLIPENPQLVGALGAALA"
     atgattaata taggtataga cataggatcg agaactattg gaatggtggt tttgcagcaa        60
     gatcaggtag tactgaccaa cctgctgaac accgggttta cgccactaaa gacagccggt       120
     gaaatgctgg cttcagtaca ccgggctctg caggatttcg agataaaaac cggttttcct       180
     gccagtccag atgagacaac tccgaattct gttcaaatta ccgccacagg ttacggcaga       240
     catgctgcta aagccgaatt cgcccagcgg gtaattactg agattaaggc ccatgcgatt       300
     ggagtaacca acctttttcc gcaggccaaa acgattctcg atattggcgg tcaagatacc       360
     aaggttattc aattagacag caaaggcaat gtaactgact ttcaaatgaa tgacaaatgc       420
     tcggccggaa ccggtaaatt tttagaggtc atggctgcgg ctctgggcta caattcaccc       480
     gaagatttcg gtcaagatgc cctgcaaggc aaaccgggca tcaaaatcag caatatgtgc       540
     actgtcttcg ccgaatcgga agccatctca ttactgcacg gaggttatac caggcgtgac       600
     attgccagtg ccctgcactc atcaactgcg gagaaggcag caagcatgct gcagcgggta       660
     ggcttagaac cgcctgttgc ctttaccggc ggcgtagctt taaatccctg tattgtcaaa       720
     atgttggggg aaatgctgca aactactctg cttataccgg aaaaccctca gttagtgggt       780
     gctttgggag cggctctggc ctga                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page