(data stored in ACNUC7421 zone)

EMBL: CP001720.PE118

CP001720.PE118       Location/Qualifiers
FT   CDS_pept        complement(127354..128649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61083"
FT                   /db_xref="InterPro:IPR024465"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2S7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61083.1"
FT                   /translation="MLPENIVLYLQKYLARDETISSKDATIRDRVYSLSAKTIKSRVSY
FT                   TSKIFELSGEASPSIPPAFQGSRWQNKKTAKQLKNWLNYRNSSLSFELNIRNWVENGLL
FT                   IRVIELANRGTSSKGVYFIPGLPLIESWNKKELSENNANRKEADKYMLRLEALVNPYDH
FT                   PGFEKIRNFARREVRQNLRVDKRAEFLLSLLSAAQTMPFFDWKEIGTFSETENMRNAAS
FT                   KTYDGKRTLYQTLLEEILQDSPEAIGLTTVSGNYALSFSARCRIDFTFGRWDFNECPVI
FT                   SNISGEEIAEIISLQAKDVHTLFLTENRAVLRKLAGHMPHEKRRHVGMIAFDGQIRSAV
FT                   YNFLKIWQAAGLNKLLVWTDFDQAAIYMLKKLYGLGFADFNVLVPKEDELTLLDYPQAI
FT                   SMLEEFIKENMLVEQESYLKDMRLLQELIFNC"
     atgctgccgg aaaacattgt gctgtatttg caaaaatatc ttgccagaga tgagacaatt        60
     agctctaaag acgcaaccat aagggatcga gtctatagtc tgtcggccaa aacaataaaa       120
     tcaagagtat cctatacgag caaaatattt gaattatccg gagaagcttc gcccagtatt       180
     ccgcccgcct ttcagggcag ccgctggcaa aacaaaaaga cagcgaaaca gctgaaaaac       240
     tggcttaatt accggaattc atccctttcc tttgaactca atatacgcaa ctgggtggaa       300
     aacggtttac tcattcgggt tatcgaactg gctaaccggg gcacttccag caaaggcgta       360
     tatttcattc cggggctgcc cttgatagaa agctggaata aaaaggagct gtctgaaaat       420
     aacgccaacc gcaaagaagc tgataaatat atgctgcgcc tggaagcact ggtcaaccct       480
     tacgaccacc cgggttttga aaaaatcagg aattttgccc gtcgggaagt caggcaaaat       540
     cttcgtgtag ataaaagagc ggaattttta ttatcactgc taagcgccgc ccaaaccatg       600
     ccttttttcg attggaagga aatcggtacc ttttccgaga cagaaaatat gcgcaacgcc       660
     gccagcaaga cttatgacgg caagcgcaca ctgtaccaga cactgctgga ggaaatatta       720
     caggacagtc ctgaagctat agggctaacc acggtatcag gcaactatgc tttaagcttc       780
     tctgcccgct gccgtataga ttttacattt ggccgctggg atttcaacga atgccccgtt       840
     atatccaaca tatccggcga agaaatagct gaaataatct cactgcaggc caaagatgta       900
     cacacactat ttttaaccga gaacagggct gtgctgagaa aactggcggg tcacatgcca       960
     catgaaaaac gccgccacgt gggaatgatt gctttcgacg gtcagattcg ctccgctgtc      1020
     tataatttcc ttaaaatttg gcaggctgcc ggcttaaata agctgcttgt ctggactgat      1080
     ttcgaccagg cagctatata tatgctaaaa aaattgtacg gccttggatt tgcggacttt      1140
     aatgttttag ttcccaaaga agacgaatta acgcttttag attatcctca ggctatcagt      1200
     atgctggagg aatttataaa agaaaacatg ctggtggagc aggaatccta cttaaaggat      1260
     atgagactgc tgcaagaatt gatttttaat tgttag                                1296
//

If you have problems or comments...

PBIL Back to PBIL home page