(data stored in ACNUC7421 zone)

EMBL: CP001720.PE120

CP001720.PE120       Location/Qualifiers
FT   CDS_pept        130296..130946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0122"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61085"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2S9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61085.1"
FT                   /translation="MSGDLYLTPRQKRVVQFIAATGNVSLMRHHTGVTRQDIKKMLEIT
FT                   DNRDLEAFIKVCNLVLKEETVPAQVLYDDILNRYVYVQTVDPVVLLDRIPVKTLLLFLF
FT                   MYYQQRALGHPQTRLLDLLEIVDSSLVENPRQKVLAALKPLLDYNLVKEDDEIYRVTKI
FT                   GDAFMTPLFLKKMTDVTLNKNYDLDVILEFYRKVIPRPEELGAEATDYQLSLF"
     atgagcggtg atctttatct tactccgagg caaaaaaggg tggtacagtt tatagcggct        60
     accggaaatg tcagcttgat gcgccatcat acaggtgtaa ccagacagga tattaaaaag       120
     atgctggaaa tcacggataa tcgcgatttg gaagcattta taaaagtatg taatcttgtg       180
     ttaaaggaag agactgtccc ggcacaggta ttatatgacg acattttgaa cagatatgtt       240
     tacgtgcaga cggttgatcc tgtggttttg cttgaccgaa ttccggtgaa aacgcttctt       300
     ttgtttttgt tcatgtacta ccagcagagg gctttgggcc atcctcagac tagactttta       360
     gatttgctgg agattgttga ttcgtccctg gtggagaatc cccgtcaaaa ggtgctggcc       420
     gcactgaagc cgctgctgga ctataacctg gtaaaagaag atgacgaaat ttaccgtgtc       480
     acaaaaatcg gcgatgcttt tatgactcct ctttttctga agaaaatgac ggatgttaca       540
     ttgaataaaa attatgatct ggatgtgatt ttggagtttt atcgaaaggt aattcccaga       600
     ccggaggaac tgggggcaga ggcaactgat taccagcttt ctttatttta a                651
//

If you have problems or comments...

PBIL Back to PBIL home page