(data stored in ACNUC7421 zone)

EMBL: CP001720.PE121

CP001720.PE121       Location/Qualifiers
FT   CDS_pept        131079..131636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0123"
FT                   /product="protein of unknown function DUF820"
FT                   /note="PFAM: protein of unknown function DUF820; KEGG:
FT                   noc:Noc_2546 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61086"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2T0"
FT                   /inference="protein motif:PFAM:PF05685"
FT                   /protein_id="ACV61086.1"
FT                   /translation="MGLNVPTVSTGKKYTIEDYLKLDDGQSYELIEGELILVPRPRTKH
FT                   QKIANRFFANLDRFVLMNNLGEVNGDVDVYLEEEVVAPDVFFVAKERLTIVGEMNIQGA
FT                   PDLVVEVLSPSTARYDRKKKSRLYFRNGVKEYWLADPDQQLVEVLVAGEKEWKWIGVFD
FT                   REDILTSNLLPGLEINLGEIFR"
     gtgggtttga atgtgccaac tgtttcaacc ggcaaaaaat atactattga ggattattta        60
     aagttagatg acggccagag ttatgagtta attgaggggg aattgatttt ggttccgcgg       120
     ccacggacta aacaccagaa aattgccaat aggttttttg caaacttaga ccgttttgta       180
     cttatgaata acctcgggga agttaatgga gatgtggacg tttatctgga agaggaagtt       240
     gttgccccgg atgtattttt tgttgccaaa gagagactaa ctattgttgg agaaatgaat       300
     attcagggcg caccggacct ggtagttgag gtattgtctc cgtctacggc caggtatgat       360
     aggaagaaaa agagccggtt atattttaga aatggagtta aagagtattg gctggcagat       420
     ccggatcagc agttagttga agttcttgtt gcaggagaaa aagaatggaa atggattgga       480
     gtatttgatc gggaggacat cttaacttct aatttattgc ccggtctcga gataaattta       540
     ggtgagatct ttcgataa                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page