(data stored in ACNUC7421 zone)

EMBL: CP001720.PE122

CP001720.PE122       Location/Qualifiers
FT   CDS_pept        131786..132661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0124"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   gsu:GSU2769 metallo-beta-lactamase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61087"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2T1"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACV61087.1"
FT                   /translation="MQVSEHVHALKIPFQVKLPSGVALDRFVYAYLIYGKEICLIDSGV
FT                   TGAEELIFDYIKKTGRRPEEISLLVQTHAHPDHIGATRAIKNATGCKVAIHRAEVPWLE
FT                   DVELQVKERPVPGFHNLVGGSAKVDLILEYGSVLKLDEVLHLEVIYSPGHSKGSVSLLL
FT                   PKDKVLFSGDVVPLAGDMPIYDDVMALVSSVKRLKNEKFELLLAAWDEPRDSKQARGLM
FT                   DEALHYLKRIDDAVVKVSGGEQAKVDEEFLKQVLAELGLPAAAANPLIARSFASHLKIL
FT                   ERYYLPIQWF"
     atgcaggttt ctgaacatgt tcatgctttg aaaatacctt ttcaagtgaa gctgccgagc        60
     ggtgtcgcgc ttgaccggtt tgtatatgcc tatctcatat acggcaaaga gatatgcctt       120
     attgacagcg gggtgaccgg tgcggaggag cttatttttg attacattaa aaaaacaggg       180
     cgaagaccgg aggagatttc actgctggtt cagactcacg ctcatcccga tcatatcggc       240
     gcaacaaggg caatcaaaaa cgccaccggt tgtaaggtag caattcaccg tgcggaagtt       300
     ccctggcttg aggatgtgga attgcaggtt aaagagcgac cggttcccgg ttttcataac       360
     cttgtgggcg gttcggccaa agtggatctt attcttgaat acggcagcgt gctgaaactg       420
     gacgaagttt tgcacctgga agtaatttat tctcccggtc attccaaagg ttctgtttca       480
     cttttattgc ccaaggataa ggtgcttttc tccggtgatg tcgtcccttt agcgggagac       540
     atgccaatct atgatgatgt tatggccttg gtaagttccg ttaagaggct gaagaatgag       600
     aaatttgaat tgcttttggc cgcctgggac gagcccaggg acagtaaaca ggctcgcggg       660
     ctaatggacg aagcactgca ttatttaaag agaattgacg atgccgttgt caaagtgtcc       720
     ggcggtgaac aggcaaaggt agatgaagaa ttcttaaagc aggtattggc cgagttgggt       780
     ttgcctgcgg cggcagctaa cccgttaata gccagatcct ttgcatcaca tctaaagatt       840
     ttagagagat actatttgcc tattcagtgg ttttag                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page