(data stored in ACNUC7421 zone)

EMBL: CP001720.PE123

CP001720.PE123       Location/Qualifiers
FT   CDS_pept        complement(132785..133531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0125"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: cps:CPS_3640 phosphate ABC transporter, ATP- binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61088"
FT                   /db_xref="GOA:C8W2T2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2T2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV61088.1"
FT                   /translation="MSVHLKNLCVFFNGTPVLKKINLEFKEQVIYAIVGPSGCGKTTLL
FT                   RSINRTAELDRGFSCSGEILLYGKNIYQERDAAEIRRKIGIVFQTPVALPLSIKENVIF
FT                   GIRYLGGANNKQLNYTAEHCLKQAGLWQEVKDKLHKPARELSGGQIQRLSIARTLAVNP
FT                   EVLLLDEPCSNLDPVSAKLIEELLLSLSNRLTVILVTHNLFQARRIAQNTILMSVGCVV
FT                   ESGPTEVMFSTPDRQETKDYFSGLIW"
     atgtctgttc atcttaagaa tttatgtgtc ttttttaatg gcactccggt tttaaagaaa        60
     atcaacctgg aatttaaaga acaggttatc tacgctattg tcggaccatc aggctgcggt       120
     aaaactaccc tattaaggag cataaacagg acagccgagc tggacagggg ttttagctgc       180
     agcggtgaaa ttttactgta cggtaaaaat atatatcagg aaagagatgc ggcagaaata       240
     cgccgcaaaa taggcatagt ctttcaaacg ccggttgctt tgcctttaag catcaaagag       300
     aacgtgattt tcgggataag atacctggga ggggcaaata ataagcagtt aaattataca       360
     gctgagcatt gtttaaaaca agccggccta tggcaggaag ttaaagataa actgcataaa       420
     ccggcccggg aactttcagg cggtcagata caaagactat ccatagccag aacactggcg       480
     gttaaccctg aagtattatt gctggatgag ccctgttcta atttagaccc ggtttctgca       540
     aaattaatag aagaattatt attaagcctg tccaaccggc taactgttat tcttgtcaca       600
     cacaatcttt ttcaggctcg aagaatagcg cagaatacaa ttcttatgtc agtcggctgt       660
     gttgttgaaa gcgggccgac tgaagtaatg ttctccaccc ctgatcggca ggaaacaaag       720
     gattatttct ctggattaat atggtga                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page