(data stored in ACNUC7421 zone)

EMBL: CP001720.PE124

CP001720.PE124       Location/Qualifiers
FT   CDS_pept        complement(133547..134386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0126"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstA"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstA; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: sat:SYN_00058
FT                   ABC-type phosphate transport system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61089"
FT                   /db_xref="GOA:C8W2T3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2T3"
FT                   /inference="protein motif:TFAM:TIGR00974"
FT                   /protein_id="ACV61089.1"
FT                   /translation="MTVRKWLDRLWLAVFWGAGLLILVILFSILGYLFYRGWPSLSIEF
FT                   LTLTPKGLPLGSEGGVWPAITGTVYLVLIAVAAAGIPGITAAIYLVEGKDNQKFKQTIN
FT                   LIVQCMAGIPSIIIGLFGYSLLVVYLGFGISLLAGGLTLGIMIFPLILITARDALSAVN
FT                   ENYRLIGISLGVSRRYILARIIFPQAMPSILSGLLLAMGYAAGATAPIMVTAAVISAGS
FT                   PGSLLEPVMALPYHLYTLFSQQISLDKAYGTALLLVLLLLAINITALCLRGCKRKGV"
     ttgacggtca ggaaatggct ggaccgactg tggctggcag ttttttgggg agcaggcctg        60
     cttatactgg ttatactgtt cagcatattg ggctacctgt tttatcgcgg ctggccttcc       120
     ctatccattg agttcttaac cctaacgccc aaaggtttgc ccctgggttc ggaaggagga       180
     gtatggccgg ccattaccgg cactgtttat ctggtattga tagcagttgc cgctgcgggt       240
     attcccggaa ttactgccgc tatctatctg gttgagggca aagataatca aaaatttaaa       300
     cagacaataa acttaattgt gcagtgcatg gcaggaatcc cttcgattat tatcggctta       360
     ttcggctatt ccctcttagt ggtttacctg ggctttggaa tatctttact ggcaggtgga       420
     ctgacccttg gcatcatgat attcccgctt attctgatta ctgccagaga tgctctttca       480
     gctgttaatg aaaattaccg gctgatagga atatctcttg gcgtatctcg ccgctacatt       540
     ttagccagaa taatttttcc tcaggcaatg ccgtcaatct taagcgggct gctgctggcc       600
     atgggttatg cagccggtgc cacggcacct ataatggtta cggctgccgt tatttccgcc       660
     ggttcacccg gctccttatt ggaaccggtt atggctttgc cttatcatct atatactttg       720
     ttcagccagc aaatatcgct ggataaagcc tacggtaccg ccctgctgct ggtgcttttg       780
     ctgctggcaa taaatattac ggccttatgt ctgcgcggct gcaaaagaaa aggagtttaa       840
//

If you have problems or comments...

PBIL Back to PBIL home page