(data stored in ACNUC7421 zone)

EMBL: CP001720.PE132

CP001720.PE132       Location/Qualifiers
FT   CDS_pept        153332..154465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0135"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_2747 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61097"
FT                   /db_xref="GOA:C8W2U1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2U1"
FT                   /inference="similar to AA sequence:KEGG:Sfum_2747"
FT                   /protein_id="ACV61097.1"
FT                   /translation="MPFESRRPQLQLTSEEVNNLEKIIHSRTEGISRVERAKIFLLYHQ
FT                   GETVSSIARKLKTNRSKVERHINKALEFGIEIALNDLPRPGKPETITVEAKTWLISLAC
FT                   QKPKDLGYSYELWTTALLSKHVREHCEEQGHPSLKNLSRGTVSKILSANQVKPHKIKYY
FT                   LERRDPEFEQKMANVLYVYKEVEIVSEKASGSIYAFLSYDEKPGIQAIENKAPDIPPSP
FT                   GKYPCIGRDYEYVRHGTVSLMAGIDLITGHIIATVEDRHRSSEFVEFLKLTDEHYKDKE
FT                   KIKIILDNHSAHISKETRVYLNTVPNRFEFVFTPKHGSWLNLIESFFGKMAQSMLRAIR
FT                   VKSKEELKERIYTYIKEINDCPTVYRWKYKMDELTII"
     atgccgtttg aaagtcgtcg acctcaattg caattaactt ccgaagaggt aaataattta        60
     gaaaaaatca ttcattcccg cacggaaggg ataagccggg tagaacgtgc caaaatattt       120
     cttttatacc atcaaggaga gacggtttcc tcaattgctc gaaagttgaa aaccaatcgc       180
     tctaaggttg agcgtcatat caacaaagcc ttggaatttg gtattgagat tgccctaaac       240
     gatcttccac gccccggaaa accagagact ataacggtag aagctaagac ctggctcata       300
     tctcttgcat gtcagaagcc caaagactta gggtatagct acgaattatg gactactgca       360
     ttattatcaa agcatgtaag agaacattgt gaggaacaag ggcacccatc tctgaaaaat       420
     ctatcacgcg gtaccgtttc aaagattctt tcggcaaatc aagttaaacc tcataaaatc       480
     aaatattact tagaacgaag agatccggag ttcgaacaaa aaatggccaa tgtgctgtat       540
     gtttacaagg aagttgaaat tgtttctgaa aaagccagcg gatcaatata tgcttttcta       600
     tcctatgatg aaaaaccagg aatacaggct atagaaaata aagcaccaga cataccacct       660
     tctcctggga aatacccctg cattggtcgt gattacgaat atgttcgtca tggtactgtc       720
     agcctaatgg ctggaattga cttgataact gggcatatta ttgctactgt agaggatcgt       780
     catcgtagta gtgaatttgt tgaatttttg aagcttaccg acgaacatta taaggacaag       840
     gaaaaaatca aaatcattct ggataaccat tcagcccata tttctaaaga aaccagggta       900
     tatctgaaca ctgttccaaa tcgatttgaa tttgtattta ccccaaaaca tggctcatgg       960
     ctaaatttaa tcgagtcatt ctttggtaaa atggctcaat caatgcttcg agcaatccga      1020
     gtaaaatcca aagaagaact taaagaaaga atatacacct atattaagga aataaatgat      1080
     tgtcctacag tttaccgttg gaagtataaa atggatgaat taactattat ctaa            1134
//

If you have problems or comments...

PBIL Back to PBIL home page