(data stored in ACNUC7421 zone)

EMBL: CP001720.PE133

CP001720.PE133       Location/Qualifiers
FT   CDS_pept        154873..155742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61098"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2U2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61098.1"
FT                   /translation="MKGKKSDDVYLTIYGYKTFGEEHFAEEFFQMLNDANPAYLSHKIG
FT                   IYEPIKTPFSMEEAKKMWVESERVGELYGGIMLKGQKTRGDISWKNDNSNIVGLVMSRE
FT                   FVIKNNGTKKFIELAKKLFLWSNGVYGYACHISNFIYKPGLSHETCLGHITWMTLYGPP
FT                   YVEMFGKEVIQIAPCKVEEFARDRFILLTSDEPMEINPEMLEIQERIKKHPGEDAFCRK
FT                   EPFRTEPLTMEDLIAGRDSPSTEGYRSPDLSSYITDSGKKDEDDGLVVKINDDGTMMTY
FT                   KVKPEQKK"
     atgaaaggta aaaaatctga cgacgtttat ttaacgattt atggttataa aacttttgga        60
     gaagaacatt tcgcagaaga gttttttcag atgctcaatg atgctaatcc agcctatctt       120
     tctcataaaa ttggaatata tgaaccgatt aaaaccccat tttccatgga ggaagccaaa       180
     aaaatgtggg tggaatcgga aagggtgggg gaactttacg gcggtattat gttgaaaggt       240
     cagaaaacac gtggagacat aagctggaaa aatgataatt ctaatatcgt tggacttgta       300
     atgtccaggg agttcgttat aaaaaataac ggaactaaaa aattcataga gttagcaaaa       360
     aaactgtttc tttggtcaaa tggggtttat ggttacgcct gccatatttc aaactttatc       420
     tataagccag gacttagcca tgaaacatgc ctgggccata taacttggat gacgctatat       480
     gggccgccct atgttgagat gtttgggaaa gaggtaatcc aaatcgctcc ctgtaaggtt       540
     gaggaattcg ctagagatcg attcatactt ttaacttcag atgagcccat ggaaataaat       600
     ccggaaatgt tggaaataca agaaaggatc aaaaagcatc cgggggaaga tgccttttgc       660
     cgcaaagaac ctttccgtac agagccattg acaatggaag atcttattgc cggaagggac       720
     agtcctagca ccgaaggata ccgctcccct gatttatcgt catatatcac agattcgggg       780
     aagaaagacg aagacgatgg gctggtcgtg aaaatcaacg atgatggaac aatgatgaca       840
     tataaggtaa aaccggagca gaaaaaataa                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page