(data stored in ACNUC7421 zone)

EMBL: CP001720.PE134

CP001720.PE134       Location/Qualifiers
FT   CDS_pept        156836..157414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61099"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2U3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61099.1"
FT                   /translation="MIVNGTTYTESFYFHHDGTITGLYITFFTNNGHHLVPATIEDLGG
FT                   GLKRASATYTTVMNDNCIRAVDIFQPSGTWTYIEIARAQLEAKAYATSYQINGASHAAE
FT                   DFNIPTVGILNKDKGAIEIRFNPLTINNWNSYFYMDISTGRFLLFFDNTGRVLWDYGAV
FT                   NDSISSVAGIAVAHQPIYICMSCFGLVLG"
     atgattgtta atggaactac ttatacagaa agcttttact ttcaccatga tggaacaata        60
     acagggctat acattacttt tttcactaac aatggacatc acttagtacc tgcgacaata       120
     gaagatttag gcggtggtct aaagcgtgct agcgctacct acacgacagt gatgaatgat       180
     aattgtattc gcgctgtcga tatctttcag ccttccggca catggacata tattgaaatt       240
     gctcgggcac aattagaggc aaaagcttat gctacttcat atcaaattaa tggggcttct       300
     cacgccgctg aagattttaa tattcccaca gtgggaatat taaacaaaga taaaggcgca       360
     attgagatac gttttaatcc tttaacaatt aataattgga acagctattt ttatatggat       420
     ataagtaccg gacggtttct attgtttttt gacaatacag gaagagtttt atgggattat       480
     ggtgccgtca atgacagtat ctcctcagtc gccggtatag cggttgctca tcagccaatt       540
     tatatttgta tgtcatgctt tggattggtt ttgggctaa                              579
//

If you have problems or comments...

PBIL Back to PBIL home page