(data stored in ACNUC7421 zone)

EMBL: CP001720.PE135

CP001720.PE135       Location/Qualifiers
FT   CDS_pept        157431..157619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0138"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61100"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2U4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61100.1"
FT                   /translation="MYDKQRKGTPGNNQAQNKQARDAAKKYKLNKDQQRTLYDRISGEN
FT                   YTYKEIENIARDISEGN"
     atgtatgata agcaaagaaa aggaactcct ggtaacaatc aagctcagaa taaacaggca        60
     agagatgctg ctaaaaaata caaattaaat aaagatcaac aaagaaccct gtatgacaga       120
     atatccggtg agaactatac ctataaagaa attgaaaata ttgctcgaga tatttcagaa       180
     gggaattga                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page