(data stored in ACNUC7421 zone)

EMBL: CP001720.PE136

CP001720.PE136       Location/Qualifiers
FT   CDS_pept        157779..158117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0139"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: avi:Avi_3476 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61101"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2U5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61101.1"
FT                   /translation="MNIQCTWRLATESSIMVASGDFYLTRTGISDDDDFVWDKLGENRF
FT                   DEKVNEFKKRLKTNIIVTEISADIFGGLKMCLDSGISLELFPDDSMEDEFWRFIVFEGK
FT                   NKHFVVFE"
     ttgaacattc aatgtacttg gagattagct acagaaagca gtataatggt agcttcagga        60
     gatttttact taacgagaac tggcataagt gacgatgatg attttgtatg ggataaatta       120
     ggggaaaata ggtttgatga gaaagtaaat gagttcaaaa aaagacttaa gacaaacatc       180
     atagtgaccg aaatatcggc tgatatattt ggtgggttga aaatgtgtct tgattcggga       240
     attagtcttg aattattccc ggatgattcc atggaagatg aattctggag gtttattgtt       300
     tttgaaggta agaacaaaca ctttgtggtt tttgaataa                              339
//

If you have problems or comments...

PBIL Back to PBIL home page