(data stored in ACNUC7421 zone)

EMBL: CP001720.PE138

CP001720.PE138       Location/Qualifiers
FT   CDS_pept        161366..161986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61103"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2U7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61103.1"
FT                   /translation="MNFYVVNMHLFDDKKYAYGEQVDQKTGDYEKCKICGSPISMRKWL
FT                   PPLKAKLSKPSYGDFVFGTFTTFLVTERFKKEYEATGLTGIVSFEPVEIVKVSRKRDSS
FT                   PETPSYYYVSIARSKAVIDEKKSKIRRDGEISCNHCRTGGIIKSLKGIFFEDNTWSGED
FT                   IFFPVGLPGTIVVSERFADFARDYGFSNINFIPAEEYIPPWVK"
     atgaattttt atgtagttaa catgcatctt tttgatgaca aaaaatacgc ttatggagag        60
     caagttgatc aaaaaacagg tgattacgaa aaatgtaaaa tatgtggttc accgattagc       120
     atgaggaaat ggctgcctcc actaaaagca aagctatcta aaccgtctta tggggatttc       180
     gtatttggca catttacaac gtttcttgta acggagcgtt ttaagaaaga atatgaagca       240
     actggactta cgggaatagt atcttttgaa cctgtagaaa tagttaaagt aagtagaaaa       300
     cgtgattcgt ctcctgaaac tcccagttat tattatgtct cgattgctcg aagtaaagca       360
     gtaatagatg aaaaaaaatc aaaaatcaga agagacggag aaatcagttg taatcattgt       420
     agaacaggag gaataattaa atcgctaaaa ggcattttct ttgaagataa cacttggagt       480
     ggtgaagata tattctttcc agtaggtctg cccggcacaa ttgtggtatc tgagagattt       540
     gctgattttg caagagacta tggtttttca aatattaact ttattcctgc ggaagaatat       600
     attccacctt gggttaaata a                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page