(data stored in ACNUC7421 zone)

EMBL: CP001720.PE139

CP001720.PE139       Location/Qualifiers
FT   CDS_pept        162765..163019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0146"
FT                   /product="IS110 family transposase orfA"
FT                   /note="KEGG: bar:GBAA2202 IS110 family transposase orfA"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61104"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2U8"
FT                   /inference="similar to AA sequence:KEGG:GBAA2202"
FT                   /protein_id="ACV61104.1"
FT                   /translation="MQRRENYLYVGRDLHKDTHTAVLVNCWNEKLDAIVIENKPSEFSK
FT                   LAKKVDKAALRLNLSPIYGLENAYGYGRSLAVLREYLKK"
     atgcagagaa gagaaaatta cctctatgtt ggtagggact tacataagga cacccatacc        60
     gcagttctgg tgaattgctg gaatgaaaaa ctagatgcaa ttgtcatcga aaacaagccc       120
     agcgagttta gcaagctggc aaagaaggtt gataaagcag cattaagact gaatttatcg       180
     ccgatttatg gcctggaaaa tgcctacggc tacggaagaa gccttgcggt attacgggag       240
     tatttgaaga agtag                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page