(data stored in ACNUC7421 zone)

EMBL: CP001720.PE14

CP001720.PE14        Location/Qualifiers
FT   CDS_pept        17213..17644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0015"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: glo:Glov_3490 protein export chaperone SecB"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60979"
FT                   /db_xref="GOA:C8VVB0"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVB0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV60979.1"
FT                   /translation="MDNQLVSVFKFIDYKVDYINFKLNSGFTFEEPIDIDFDLRVEMAF
FT                   NSEKPKGKITINAIVFDNAEENRFPFFLDIAVTGLFAGEDGMPIEEFRKYCETSGTAAM
FT                   FPFLRSAIADITRTANIESLILPIINIRNLMKKDVESKT"
     atggacaatc agttagttag tgtttttaag tttattgatt ataaagttga ttatattaat        60
     tttaaattaa attctggttt tacatttgaa gagcctatag atattgattt tgatttgcga       120
     gttgagatgg catttaatag tgaaaaacct aaaggaaaaa taactataaa tgcgattgtt       180
     tttgacaatg cggaggaaaa taggttccct ttttttttag atattgcagt tactggacta       240
     tttgcaggcg aagacggcat gcctattgaa gagtttagaa aatattgtga gacaagtgga       300
     acggccgcaa tgtttccatt cctaagatca gcaattgctg atatcacccg aactgctaat       360
     atagagtcat tgatattacc tataattaat attcgtaatt taatgaagaa agacgtggaa       420
     tctaagacct aa                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page