(data stored in ACNUC7421 zone)

EMBL: CP001720.PE140

CP001720.PE140       Location/Qualifiers
FT   CDS_pept        163362..164495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0147"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_2747 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61105"
FT                   /db_xref="GOA:C8W2U9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2U9"
FT                   /inference="similar to AA sequence:KEGG:Sfum_2747"
FT                   /protein_id="ACV61105.1"
FT                   /translation="MPFISQRAKLDLTTEEINRLEKIIHSRTESVSHIERAKMFLLYHQ
FT                   GETIASIGRILETNRAKVERHIDKILQFGLDIALNDLPRSGRPDTITKEDKAWLVSLAC
FT                   QKPKEFGYSYELWTTDLLAKHARNHCVENGHPTLQNLAKGTVSKILSANNVKPHKIKYY
FT                   LEKRDPEFEQKMANVLYVYKEVEMVSKNDEQSMYAYISYDEKPGIQAIENIAPDLPPSP
FT                   GTYSCLARDYEYVRHGTLSLMAGIDLVTGHILAQVEDRHRSIEFVEFLKMISEYYKDIE
FT                   KIVIILDNHSAHISKETRAYLSTVPNRFEFVFTPKHGSWLNLIESFFGKMAKSMLRAIR
FT                   VKTKEELKDRIYKYIKEINDCPTVYRWKYKMDDIEII"
     atgccattca taagtcaaag agcaaaatta gatttgacaa cagaagaaat aaatagatta        60
     gaaaaaatta tacattcaag aacagaaagt gtgagtcata ttgaacgggc taaaatgttt       120
     ctcttgtatc atcaaggaga aacaatagct tcaattggta gaatattaga gactaaccgt       180
     gcaaaagtag aacgacatat agataaaatt ttacaatttg gcttagatat agcactcaat       240
     gatcttcctc gttcaggcag gccggataca ataaccaaag aagataaagc gtggcttgtt       300
     tctcttgctt gccaaaaacc taaggaattt ggatatagct atgaattatg gacaacagat       360
     ttattagcca aacatgcacg aaatcattgt gtagaaaatg gccatccaac cctgcaaaat       420
     ctagcaaaag gtacagtatc aaaaatactt tcagcaaaca atgttaagcc acataaaatt       480
     aaatattact tggaaaaaag ggatccagaa tttgaacaaa aaatggctaa cgtgttatat       540
     gtctataaag aagttgaaat ggtatcaaaa aatgatgaac aatcaatgta tgcttatata       600
     tcatatgatg aaaaacccgg tattcaagct atagaaaata ttgctccgga tcttcctcct       660
     tctcctggaa cgtattcatg tcttgctcgt gattatgaat atgttcgcca tggtacactt       720
     agtctcatgg ccggtattga tttggtaaca ggtcatatct tagctcaagt agaagaccgc       780
     catcgtagta ttgagtttgt agagtttcta aaaatgataa gtgagtacta caaagatata       840
     gagaaaatag taattatatt ggacaaccac tccgctcata tttcaaaaga aacaagggct       900
     tatcttagta ctgtcccaaa tcgttttgaa tttgttttta caccaaaaca tggatcctgg       960
     ttaaacttaa ttgaatcatt ttttggcaaa atggctaaat caatgctgag ggctattagg      1020
     gtaaaaacta aagaagaatt aaaagataga atttacaaat atataaaaga aattaatgat      1080
     tgtcctactg tttaccgctg gaagtacaaa atggatgata ttgaaataat ttaa            1134
//

If you have problems or comments...

PBIL Back to PBIL home page