(data stored in ACNUC7421 zone)

EMBL: CP001720.PE143

CP001720.PE143       Location/Qualifiers
FT   CDS_pept        168326..168442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61108"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2V2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61108.1"
FT                   /translation="MVNGKLIPINIDEALKAPPSIFVFPPGWNNWFQEDYGT"
     atggttaatg gcaagcttat tccgattaat attgatgaag ctttgaaagc accaccttcg        60
     atttttgtat tcccacccgg ttggaataac tggtttcaag aagactatgg aacctaa          117
//

If you have problems or comments...

PBIL Back to PBIL home page