(data stored in ACNUC7421 zone)

EMBL: CP001720.PE144

CP001720.PE144       Location/Qualifiers
FT   CDS_pept        168492..169361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0151"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aci:ACIAD2783 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61109"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2V3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61109.1"
FT                   /translation="MKGKKSDDVYLTIYGYKTFGEEHFAEEFFQMLQDANPAYLPHKIG
FT                   MYEPIKTPFSMEVAKKMWVDSEKAGKFYGGIMLKGRKTYGDISWKNDNSNIIGLDMSRE
FT                   LVIKNNGTKKFIELAKKLFLWSNGVYGYACHISNLIYTPGLSHKTCLGHITWMTLYGPP
FT                   YVEMFGKEVIQTAPCKVEEFARDRFILLTSDEPMEINSEMLEIQERVKKHLGEDAFCRK
FT                   EPFRTEPLTMEDLIAGRDSPSTEGYRSPDLSSYITDSGKKGEDEGLVVKINDDGTMMTY
FT                   KVKPEQKK"
     atgaaaggta aaaaatctga cgacgtttat ttaacaattt acgggtataa aacttttgga        60
     gaagaacatt ttgcagagga gttttttcag atgctccagg atgctaatcc agcttatctt       120
     cctcataaaa ttggaatgta tgaacctatt aaaaccccat tttccatgga agtagccaaa       180
     aaaatgtggg tagattcaga aaaggcggga aaattttacg gaggcattat gttgaaaggt       240
     cgaaaaacct atggagatat aagttggaaa aatgataatt ctaatatcat tggacttgac       300
     atgtccaggg aactcgttat aaaaaataac ggaactaaaa aattcataga gttagccaaa       360
     aagctctttc tctggtcaaa tggagtttat ggttacgcct gccatatttc aaacttaatc       420
     tatacaccag gacttagcca taaaacatgt ttgggtcata taacctggat gacgctatat       480
     gggcctccct atgttgagat gtttgggaaa gaggtgatcc aaaccgctcc ctgtaaggtg       540
     gaggaattcg ctagagatcg attcatactt ttaacttcag atgagcccat ggaaataaat       600
     tcggaaatgt tggaaataca agaaagggtc aaaaagcatc tgggggaaga tgccttttgc       660
     cgcaaagaac ctttccgcac agaaccattg acgatggaag atcttattgc cggaagggac       720
     agtcctagca ccgaaggata ccgctcccct gatttatcgt cgtatatcac agattcgggg       780
     aagaaaggcg aagacgaggg gttggtcgtg aaaattaacg atgatggaac aatgatgaca       840
     tataaggtaa aaccggagca gaaaaaataa                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page