(data stored in ACNUC7421 zone)

EMBL: CP001720.PE145

CP001720.PE145       Location/Qualifiers
FT   CDS_pept        169803..170726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0152"
FT                   /product="YD repeat protein"
FT                   /note="TIGRFAM: YD repeat protein; PFAM: YD
FT                   repeat-containing protein; KEGG: pca:Pcar_0129 Rhs family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61110"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2V4"
FT                   /inference="protein motif:TFAM:TIGR01643"
FT                   /protein_id="ACV61110.1"
FT                   /translation="MGVALPNGQSESLTYNNANRLTRVTLSNGTCYNYSYDGAGDLTGV
FT                   TEQNGDGYSWNYDSAHRVTGTTDPFGYQLTYIWDKSGNFRSKNGCTYYYDGSNNMYEAK
FT                   LPNAFIYYGRDDEGRVFNIEYNPVYTLNGQVHYATSQRIMNYLPNGWCNSILDQYFPYA
FT                   SGYSYGYNADGTISGYNSWNGTHSFSYDADGRLTSWTYNGVQQNYTYDAAGNLLTKGDM
FT                   EFTYNRSNEITNPGFTYDRNGNMTGDGSFNYTYNALNQLVQVNKVSNGSLVATYTYNHD
FT                   GSRRSKTTSQGTTNYNWDVFGNCDFV"
     atgggagttg ccctgcccaa cggccagagt gagagcctga cctacaacaa tgccaaccgt        60
     ctaaccaggg tgaccttgag taacggcaca tgctataatt attcatacga tggtgcgggc       120
     gatctaaccg gcgtcaccga gcagaacggc gacggctact cctggaacta cgacagcgca       180
     cacagagtga caggcacgac tgatcctttc ggctaccaac ttacgtacat ctgggacaag       240
     agcggcaact ttagaagtaa gaacggttgc acttactatt acgatggcag caacaatatg       300
     tacgaagcaa aactgcccaa tgcctttatc tactatggcc gagacgacga agggcgtgtc       360
     ttcaacatcg agtacaaccc ggtctacact ctgaatggcc aggtgcatta cgccaccagc       420
     caaagaataa tgaactatct gcccaacggc tggtgcaaca gcatcctgga tcagtacttc       480
     ccctatgcat ccggctattc atatggctac aatgcagacg gcaccatctc cggttacaac       540
     tcatggaatg gcacgcacag tttcagctat gacgccgacg gcaggcttac ctcatggaca       600
     tacaacggtg ttcaacagaa ttacacatat gatgccgccg gcaacctcct gaccaaaggg       660
     gacatggaat tcacctataa cagaagcaac gaaattacga atcccggttt cacctacgat       720
     cggaacggca acatgaccgg cgacggaagc ttcaattaca cctataacgc cctgaaccag       780
     ctcgtccagg tcaacaaggt atccaacggc agcctggtgg ccacctatac ctacaaccac       840
     gacggtagca ggaggagcaa gaccacctct cagggaacaa ccaactacaa ctgggatgtc       900
     ttcggtaact gtgactttgt ctga                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page