(data stored in ACNUC7421 zone)

EMBL: CP001720.PE146

CP001720.PE146       Location/Qualifiers
FT   CDS_pept        170739..171242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0153"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61111"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2V5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61111.1"
FT                   /translation="MKEYFPFIFIIHSIKYYCIWYSNERDGFITESNKIRYFDNMENLF
FT                   TYATSNNIKIEERKTILSIDKALTWLQQNKKEIDCTYFLDYWNIISDLANSLDTKFYGN
FT                   QDNNIINLIYDKLFYGNNLTALKHDGETFTPDWTAEEVNELIEVIKDGIRVVGFQFEAM
FT                   SVNL"
     gtgaaggaat attttccatt catattcata attcatagta taaaatatta ttgtatttgg        60
     tattccaatg aaagagacgg tttcataacg gaatcaaata agataagata ttttgataat       120
     atggagaatc tttttactta tgcaaccagc aataatataa agattgaaga aagaaaaacc       180
     attttatcaa ttgataaagc cttaacatgg ttacaacaga ataaaaaaga gatagattgc       240
     acatatttcc ttgattattg gaatattatt tctgatttag cgaattcgtt agacactaaa       300
     ttctatggga atcaagacaa taacataatt aatttaattt atgacaagtt attttatgga       360
     aataatttaa cagctttaaa acatgatggg gaaacgttta cacctgattg gacagcagaa       420
     gaagttaatg aattaattga agttattaag gatggcatac gcgtagtagg tttccaattc       480
     gaggcaatgt ctgttaattt gtga                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page