(data stored in ACNUC7421 zone)

EMBL: CP001720.PE147

CP001720.PE147       Location/Qualifiers
FT   CDS_pept        172017..172919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0155"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_7292 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61112"
FT                   /db_xref="InterPro:IPR006842"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2V6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61112.1"
FT                   /translation="MSQDYDLILKALAERYPSHFVEMVRGITVEDVQRVEKEAIAVKRE
FT                   SDMLFRVSEDGYEYLMAIEMQIRPDREMPRRLLEYTAMQHREFKKPVYPVIVNLTGHKK
FT                   KDESYCFDCLDFTVVTFNYRQINLSDLPGQDFLRSGPVGLIPLVVLMRHDEAPEEVFAK
FT                   CVQRVDEVQDEGLRADLYLGLAVLSTIKFTREIILKYIEVNKMENSPLFDGIREKWIDQ
FT                   GEQIGFQKGIQKGIQQAMQQSILEALEENIGMCSSKIGNKLSSIRDISVLKTLHRRAVK
FT                   AKTLEEFLETLNSVTKVNN"
     atgtctcaag attacgatct tatattaaag gcactggctg aaaggtaccc atctcatttt        60
     gtagaaatgg tacgaggtat aactgtagaa gacgttcagc gagtagaaaa ggaagctata       120
     gcggtaaagc gagagtctga tatgcttttt cgagttagtg aagatggcta cgaatatctt       180
     atggctattg aaatgcagat taggccggac cgggaaatgc ctcgacgact tttagaatac       240
     actgctatgc agcatcggga gtttaagaaa ccagtttacc ctgtaatagt aaaccttaca       300
     gggcataaaa agaaggatga aagttactgc tttgattgtt tggattttac ggtggttacc       360
     tttaattata gacagattaa cttatcagac ttacccggac aggatttctt gcgaagcgga       420
     ccagtaggat tgattccctt ggtagtttta atgcgacatg atgaggcacc ggaggaagta       480
     tttgcaaaat gtgttcaaag agttgatgag gttcaggatg aaggtctacg ggcagattta       540
     tatcttggac tggcggtatt gtcaacgatt aagtttacca gggaaataat tctaaaatat       600
     attgaggtga ataaaatgga aaactccccg ttatttgatg gtattcgtga aaaatggatt       660
     gatcagggtg agcaaatagg gtttcaaaag ggaatacaaa agggaataca acaggcaatg       720
     cagcagtcta tacttgaagc tttagaagag aacattggaa tgtgttcttc taaaataggc       780
     aataaattgt cttctattcg ggatataagc gtcctgaaaa cgcttcaccg aagggctgta       840
     aaagctaaaa cattagagga atttttagaa actttaaata gtgttacaaa ggttaataat       900
     taa                                                                     903
//

If you have problems or comments...

PBIL Back to PBIL home page