(data stored in ACNUC7421 zone)

EMBL: CP001720.PE148

CP001720.PE148       Location/Qualifiers
FT   CDS_pept        173893..174144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0157"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pca:Pcar_0788 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61113"
FT                   /db_xref="GOA:C8W2V7"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2V7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61113.1"
FT                   /translation="MTKFSKLYTKIVRNPKDVEFDELDKILKKYNFKRRQPSKGSSHYT
FT                   YFHDKIDDIVTVPKDKPIKSIYVKIAIAAIEKLRKEDK"
     atgactaaat ttagcaagct atacactaaa atagttcgta atcctaaaga tgtagaattc        60
     gatgagcttg ataaaattct taaaaaatat aactttaaac ggcggcaacc aagtaaaggc       120
     tccagccatt acacttactt tcacgataaa atagatgata tagtcacagt cccaaaagat       180
     aaaccaatta aatccattta cgttaaaatc gccatagccg caatagaaaa attaagaaaa       240
     gaggataagt aa                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page