(data stored in ACNUC7421 zone)

EMBL: CP001720.PE149

CP001720.PE149       Location/Qualifiers
FT   CDS_pept        174146..174511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0158"
FT                   /product="protein of unknown function UPF0150"
FT                   /note="PFAM: protein of unknown function UPF0150; HicB
FT                   family protein; KEGG: noc:Noc_2743 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61114"
FT                   /db_xref="GOA:C8W2V8"
FT                   /db_xref="InterPro:IPR008651"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2V8"
FT                   /inference="protein motif:PFAM:PF03681"
FT                   /protein_id="ACV61114.1"
FT                   /translation="MKNMEYYLKLNYDIKLRKLTKDEGEGWLAQIPLLPGCMSDGNTPV
FT                   EALTNIEDAKKSWIETCLELGRPVPEPITDEHSGQLRIRIPKTLHRILAERAKEENISL
FT                   NQYINYQLSRGVGYTPK"
     ttgaaaaaca tggaatatta tctcaaactc aattatgata taaaattaag aaaactcaca        60
     aaagatgagg gtgagggatg gttggctcaa atcccactac ttcctgggtg catgtctgat       120
     ggcaacacac cagtagaagc ccttacaaat atagaagatg ctaaaaaatc ctggattgaa       180
     acatgcctcg aacttggccg ccctgtacct gaaccaataa ccgatgaaca ttccggccaa       240
     ttaagaattc gtatacccaa aacccttcat cggatattag ctgaaagagc gaaagaggaa       300
     aatatcagcc ttaaccagta tattaactat cagttatctc gcggtgttgg ttatactcct       360
     aagtaa                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page