(data stored in ACNUC7421 zone)

EMBL: CP001720.PE15

CP001720.PE15        Location/Qualifiers
FT   CDS_pept        complement(18103..18381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60980"
FT                   /db_xref="GOA:C8VVB1"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVB1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV60980.1"
FT                   /translation="MCYGYPSVVTGFICLFMKKGKVLLHLKIRIKWILVIVSILIAIMS
FT                   GTILLTDQYVQRIDLQYIMSPNEVPKAMLYLFWRHMFFLTYSVYYAQ"
     gtgtgctatg gttatcccag cgtagtgact ggtttcattt gtttattcat gaaaaaaggg        60
     aaggtattgc ttcatttgaa gattaggatt aaatggatct tggttattgt tagtatttta       120
     atagctatta tgtcaggtac aatattactc acagatcaat acgttcagcg aatagatttg       180
     caatatatta tgagtcctaa cgaggttcct aaagcgatgt tatacttatt ctggaggcat       240
     atgtttttcc tgacgtacag tgtctactat gctcaatga                              279
//

If you have problems or comments...

PBIL Back to PBIL home page