(data stored in ACNUC7421 zone)

EMBL: CP001720.PE150

CP001720.PE150       Location/Qualifiers
FT   CDS_pept        176008..183984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0160"
FT                   /product="YD repeat protein"
FT                   /note="TIGRFAM: YD repeat protein; PFAM: YD
FT                   repeat-containing protein; KEGG: bsu:BSU39230 cell
FT                   wall-associated protein precursor (CWBP200, 105, 62)"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61115"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2V9"
FT                   /inference="protein motif:TFAM:TIGR01643"
FT                   /protein_id="ACV61115.1"
FT                   /translation="MLGGLRLEKKYYMPKPSSRIKKCICCVLTIIMLLISNTGFIPNYY
FT                   ITNNAKAMSLPNNSQTSIASGNSGNESPSDNMTNQSETETSAQNNSVTGDVYVEQKIFT
FT                   SDSLMFTPFNSQKALTERVYSDNPDYINKVINYSEIPNTFQSTGEYVYQSGDIHMQQVI
FT                   HMPKMMERPDISNPSVSNTVYNQTSTLNQNNENSIASYVYENNNSSDIIASDTESTYNS
FT                   SAAPASDFDTSAITDSKTGMEENDLYLIDSGQIMNPDQSDSGVVDSPAQENFTSQQTDL
FT                   SNTSVASDVHSTGRNMNTIFPIQNKSGPFTVGFSRHAGSDLLRFSYKNANLMLNPLNPA
FT                   SVSGSVYKNTITYENIYPNTNIRYTLEKNRLKEDIIVQKYTGVNEFNFQLSVSNAVYDN
FT                   KSSGEISFLDPGSSTPLFYMAKPFAVDKNGNRCELVNIVISDTGSLKLTVDPDWLKKAV
FT                   YPIIIDPTIYLPDAIFTRSSTAYNLEGVQVQANQPRYEASKFGQAIMIEEGTTNLFDQS
FT                   QLSTFYSFPSNTHAIQQSNGFWRLSKGTDNEFLCNYNISIVNGTTYTESFYFHHDGTIT
FT                   GLYITFFTNNGHHLVPATIEDLGGGLKRASATYTTVMNDNCIRAVDIFQPSGTWTYIEI
FT                   ARAQLEAKAYATSYQINGASRAAEDLNIPTVGILNKDKGAIEIRFNPLTINNWNNYFYM
FT                   DINTGRFLLFFDNTGRISWDYGAVNDSISSVAGIAVAHQPIDICMSWDATVGTRELMVN
FT                   GQSIGTKAFTAPAGLPDSVGLVNNFATLLDDLRISSRARTLAEHQAAYNSGQPLPIDGF
FT                   TKCKMSFDGNLYTASYGVINTGITAAFSRSSIAYKQNGTQVQVNQPRYEASKFGQAIMI
FT                   EEGTTNLFDQSQLSTFYSFPSNTHAIQQSNGFWRLSKGTDNEFLCNYNISIVNGTTYTE
FT                   SFYFHHDGTITGLYITFYTNNGHHLVPATIEDLGGGLKRANATYTTVMNDNCIRAVDIF
FT                   QPSGTWTYIEIARAQLEAKAYATSYQINGVSRAAEDLNIPTVGIFNKDKGTIEIRFNPL
FT                   TINNWNNYFYMDISTGRFLLFFDNTGRVLWDYGAVNDSISSVAGIAVAHQPIDICMSWD
FT                   ATVGTRELMVNGQSIGTKAFTAPVGLPDSVGLVNNFATLLDDLRISSRARTLTEYQAAY
FT                   SSNQPLPIDDATTCKMSFDNNLYTTDMWGTGILPYWNYNTASLGGGWNTPVNTFNLNML
FT                   LNKSLFYLPGHGLPIGESITYNSIDGRNGPLGIGWHLGSDTGLTECKDGSVIYNGGDGS
FT                   SHAFTPNGSGGYTAPSGIYLTLQKTAPGNFIINDKKHNTYTYQNNKPTQSIDRNNNITT
FT                   YTYDNNGRLSQLYDASGRKITYAYNSAGQVTSISDPANHAYRFTYQNNKLISATDPSNN
FT                   TFTLSYDSNGHLNSFTDPLNRKTTFNINPNGQLLSYNDARSNDQDFYTTTFNQFLQSNT
FT                   MVTTITDPGNRTNTYHHDNNTGNLIKQQDGVGNTWNYTWTDNNLTQSQDAKGTTNCQYD
FT                   NMGNMTQKTITVDSNPGNNIIETMTYNNYNELLTKKDNNGRETNYTYNSQGNLLSTSDP
FT                   NEKASSSYSYDQYGNIIQYNPNVLGYHNLVLNGSMEMLDTNDNLPANWGMNGSATVSRD
FT                   DSFHPHGNYSLKISNTTAPYCYFRQDINNTNFSLDALTLRAEVKLNKVTGGISSDGEEP
FT                   FGEDSCSGLKIGFLFHDDYGNYAYVYAICTGSGRTTITLPTTVPFLPSPPYHGALYHVQ
FT                   VFMGLNNSSGTAWFDGVQLLCKGSCSQDHIISQFNSVENSSFEDTLDYWTPGGAATVNS
FT                   SLSWGGSYSLKMTAAGTTYQDVPTYAGEPLTLSGMINTSGVSGSGACYRIDYYDASNNL
FT                   ISGTSVQTACISGTQGWTRMASMANAPANANHARLQCILNGSGAAYFDDVKLTPINSMQ
FT                   YTYDKPSDYTNPGSYTGGNYMTLSEDALGIQNAYAYDANVGNMIGHADPLNHITWFNYD
FT                   TLNRLIRVTDPLNRKAYYQYDPVSNLIYTRDPRSASSSDNTYSTFYGPNNLNRLSALTD
FT                   SQNRSATYTYDRSGNLTGIALPNGQSESLEYDNANRLSKITLSDGKYYNYYYDGAGELI
FT                   SVTDQNGAGCSWNYDGAHRVTGTTDPLGYQLNYSLDKSGNLELESGIDYSCHYKYDGGN
FT                   NIYKLYLPGAIIYYNRDGQGRVFNVEYNPSYIVNHQLHYATSQRIINYLVNGWCISIQD
FT                   QYFPYRSGYSYGYYADGTISGYSSWNGTHSFSYDADGRLASWTHGGIQQNYTYDAAGNL
FT                   LTKGNRTFAYNNINEITSPGFTYDQNGNMTGDGSFNYTYNALNQLVRVNKASDGSLVAT
FT                   YTYNHDGTRRNKVTAQGTTNYNWDASGNLIREIGPNGTYCYYYVSGKLIAFENNQQLYI
FT                   VHDNLRGDVISLSMTDDYGNTDQENRYDYDPWGTPICEDESVKSPFRYAGYYYDTETGL
FT                   YYLKSRYYSPALGRFLTRDPHSFINHADPQTLNLYAYCGNNPVSTVDPTGHWDEEPSEG
FT                   YVVSPDYLENTATARIINSNVFQNILMGISVGEGLRALKFFKGAGNLKLTSDALKKIGT
FT                   KAESSGIRAVKGTADDAWDFFRNQVNISSIKEVKPGVFVGKDGNGLTFTYRAASKSGPP
FT                   TIDVNGIQGLRKIKFLP"
     atgttagggg gtctaagatt ggagaaaaaa tattatatgc caaaaccttc ttcaaggatt        60
     aagaaatgca tctgttgtgt cttaacaata ataatgctgc taatttcaaa taccggtttt       120
     attccgaatt actatatcac aaataatgca aaagctatga gcctaccgaa taactcacag       180
     acatcaattg cctcagggaa ctccggcaac gaatctccaa gtgacaatat gaccaatcag       240
     tcagaaacgg agacttccgc acaaaataat agtgtcaccg gagatgttta tgttgagcaa       300
     aaaatattca caagcgactc attgatgttt acacccttta attctcaaaa agctctgact       360
     gaaagagtct actcggataa tcctgattac atcaataagg tgataaacta ttccgaaatc       420
     ccgaacacat ttcaatcaac cggcgagtat gtttaccagt caggcgacat ccatatgcag       480
     caggtcattc acatgccaaa gatgatggaa aggcctgata tctctaatcc cagcgtaagt       540
     aatactgttt ataatcaaac ttcaacatta aaccagaaca atgaaaatag cattgccagc       600
     tatgtttatg aaaataacaa tagttctgat attattgctt cagatactga aagcacctac       660
     aattcatccg ccgcaccggc aagtgatttc gatacttcag caatcaccga ttcaaaaact       720
     ggtatggaag aaaacgatct atatttgata gattccgggc agattatgaa cccagaccag       780
     agtgattccg gcgttgttga cagcccggcc caggaaaatt tcacctccca acaaacggat       840
     ttaagtaaca caagcgttgc ctctgatgta cactcaacag gcaggaacat gaacacaatc       900
     tttcccatcc aaaacaaatc cggtcctttt actgttggct tttcccgcca tgccggcagc       960
     gacctgctgc ggttctctta caaaaacgcc aatttgatgc tgaatccatt gaaccctgcc      1020
     tccgtatccg gcagtgtcta caaaaacacc attacatacg aaaacatata tcctaataca      1080
     aacatcagat acacattaga gaaaaaccgg cttaaagagg atataattgt ccaaaagtat      1140
     accggtgtta atgaattcaa ttttcaacta agcgtaagta atgccgttta tgacaataag      1200
     tccagtggag aaattagttt tttagatccc ggctcatcta cacccctttt ttacatggcc      1260
     aagccatttg ctgttgataa gaacggaaat cggtgtgaat tagttaacat cgtgataagc      1320
     gatactggct cactaaaact tacggttgat cccgactggt taaagaaagc cgtttaccct      1380
     ataattattg atcctactat ttatttgcct gacgcaatat ttacccgttc gtcaactgct      1440
     tacaacctgg aaggtgttca ggttcaggca aaccagccac gttatgaggc aagcaaattt      1500
     ggacaggcaa taatgattga ggaaggaaca acgaaccttt ttgatcaaag tcaattatcc      1560
     acattttata gttttccatc aaacacacat gcaatccagc aaagcaatgg tttttggcga      1620
     ttatcaaaag gaactgataa tgaatttctc tgcaactata acatcagtat tgttaatgga      1680
     actacttata cagaaagctt ttactttcac catgatggaa caataacagg gctatatatt      1740
     acttttttca ctaacaatgg acatcactta gtgcctgcga caatagaaga tttaggcggt      1800
     ggtctaaaac gtgctagcgc tacctacacg acagtgatga atgataattg tattcgtgct      1860
     gtcgatatct ttcaaccttc cggcacatgg acatatattg aaattgctcg ggcacaatta      1920
     gaggcaaaag cttatgctac ttcatatcaa attaatgggg cttctcgagc cgctgaagat      1980
     ttgaatattc ccacagtggg aatattaaat aaagataaag gcgcaattga gatacgtttt      2040
     aatcctttaa caattaataa ttggaacaac tatttttata tggatataaa taccggacgg      2100
     tttctattgt tttttgacaa tacaggaaga atttcatggg attatggtgc cgtcaatgac      2160
     agtatctcct cagtcgccgg tatagcggtt gctcatcagc caattgatat ttgtatgtca      2220
     tgggatgcaa ctgttggtac cagagaatta atggttaatg gccaatcaat cggtacgaaa      2280
     gcttttacag caccagctgg tttacctgat tccgtaggtt tagttaataa ttttgccact      2340
     ttgcttgatg atctccgcat ctcctctcgg gcccgcactt tagctgagca tcaggctgcc      2400
     tataatagtg gtcagccact acccattgat ggcttcacga aatgtaagat gagcttcgat      2460
     ggtaatctgt atacggcatc ttatggtgtg ataaatacag gaatcactgc ggcattttct      2520
     cgttcatcaa ttgcatataa acaaaacggc acacaagttc aggtaaacca gccgcgttat      2580
     gaggcaagca aatttggaca ggcaataatg attgaggaag gaacaacgaa cctttttgat      2640
     caaagtcaat tatccacatt ttatagtttt ccatcaaaca cacatgcaat ccagcaaagc      2700
     aatggttttt ggcgattatc aaaaggaact gataatgaat ttctctgcaa ctataacatc      2760
     agtattgtta atggaactac ttatacagaa agcttttact ttcaccatga tggaacaata      2820
     acaggactat atattacttt ttacactaac aatggacatc acttagtacc tgcgacaata      2880
     gaagatttag gcggtggtct aaaacgtgct aacgctacct acacgacagt gatgaatgat      2940
     aattgtattc gcgctgtcga tatctttcaa ccttccggca catggacata tattgaaatt      3000
     gctcgggcac aattagaggc aaaagcttat gctacttcat atcaaattaa tggggtttct      3060
     cgcgccgctg aagatttgaa tattcccaca gtgggaatat tcaacaaaga taaaggcaca      3120
     attgagatac gttttaatcc tttaacaatt aataattgga acaactattt ttatatggat      3180
     ataagtaccg gacggtttct attgtttttt gacaatacag gaagagtttt atgggattat      3240
     ggtgccgtca atgacagtat ctcctcagtc gccggtatag cggttgctca tcagccaatt      3300
     gatatttgta tgtcatggga tgcaactgtc ggtaccagag aattaatggt taatggccaa      3360
     tcaatcggta caaaagcttt tacagcacca gttggtttac ctgattccgt aggtttagtt      3420
     aataattttg ccactttgct tgatgatctc cgcatctcct ctcgggcccg taccttaacc      3480
     gaatatcaag cagcctacag cagcaaccag ccgttaccca ttgatgacgc cacaacatgt      3540
     aagatgagtt tcgacaataa cttatatacc accgatatgt ggggaaccgg cattctgccc      3600
     tattggaact acaacacagc aagcctgggc ggagggtgga acaccccagt aaacaccttc      3660
     aacctgaaca tgctcttaaa caaatccctt ttctatctcc caggtcatgg tttacccatc      3720
     ggagaaagca tcacctacaa ttccattgac ggcagaaacg gccccctggg cattggctgg      3780
     catcttggtt ccgacaccgg cctaaccgag tgtaaagacg gaagcgtcat ttataacgga      3840
     ggcgacggct catcccatgc ctttacacca aacggaagcg gcggatatac cgcgccttcc      3900
     ggtatctatc ttactctgca aaaaacagct ccgggaaact tcataatcaa cgacaaaaaa      3960
     cataacacat acacctacca aaacaataaa ccgactcaaa gcattgaccg gaacaacaac      4020
     ataacaacct atacttatga taacaacggg cggctttcac agctttacga cgcttccggc      4080
     cgtaaaatca catacgctta taactccgcc ggccaggtga catctataag tgacccggca      4140
     aaccatgcat acagatttac ctaccaaaac aacaaattaa tctcagcaac cgatccatca      4200
     aataatacat ttaccctcag ctacgattca aacgggcatc tgaattcctt taccgatccg      4260
     ttaaaccgta aaaccacttt caacataaac ccaaacggcc agttgctgag ctataacgac      4320
     gcacgttcca acgaccagga cttctataca acaaccttta accaattcct ccaaagcaat      4380
     acaatggtca ccactatcac cgacccaggc aacaggacaa acacctacca tcatgacaat      4440
     aataccggca accttatcaa acagcaggac ggagtcggca acacctggaa ctatacctgg      4500
     actgacaaca accttaccca gtctcaagac gctaaaggca caacaaactg ccaatatgac      4560
     aacatgggca atatgaccca aaaaacaatt accgtggaca gcaaccccgg caacaacatc      4620
     atcgaaacca tgacctacaa caactacaac gagcttctaa caaaaaaaga caacaacggc      4680
     agagaaacta attacacata caacagccag ggaaacctgc tctccacatc cgatcccaac      4740
     gaaaaggcat caagcagcta tagttacgac caatatggca acatcatcca atacaaccct      4800
     aacgtgctgg gataccacaa tctagtccta aacggcagta tggagatgct cgacaccaat      4860
     gataacctgc cagccaattg gggcatgaac gggagcgcca ctgtgagccg ggatgattct      4920
     ttccacccac atggcaacta ctcgctcaaa atcagcaata ccactgcacc atactgttat      4980
     tttagacagg atataaataa cactaacttt agcttagacg cattaacact gagagcagag      5040
     gttaaactta acaaagtcac aggcggtatt agttctgatg gtgaagaacc atttggagaa      5100
     gatagctgca gcggcttaaa aattggtttt ctcttccatg acgattacgg caactacgca      5160
     tatgtatacg ctatatgtac cggttccggg agaaccacga ttaccctgcc gaccacagta      5220
     ccgtttctcc ctagcccacc ttaccatggc gctttatatc atgtgcaggt cttcatggga      5280
     ttgaacaatt caagcggtac cgcctggttt gacggagtgc agctcctgtg caagggcagc      5340
     tgcagtcaag atcatatcat cagtcaattc aactccgtgg aaaacagcag ttttgaagac      5400
     accttggact actggactcc cggaggtgcc gctactgtta acagcagcct ttcctgggga      5460
     ggttcctact cattaaaaat gaccgcggcg ggaaccacct accaggacgt tcccacctac      5520
     gcaggggagc cgctgacctt atccggcatg attaatacca gcggtgtcag cggcagtggt      5580
     gcctgctatc ggatcgacta ctatgacgcc tcgaacaacc tgatctccgg gacttccgta      5640
     caaaccgcct gtatcagcgg aactcagggc tggacaagaa tggcaagtat ggccaacgct      5700
     cctgcaaatg ccaaccacgc ccggctccaa tgcatactaa acggtagcgg tgcagcctat      5760
     ttcgacgacg tgaaattgac acctataaac agcatgcaat atacttacga taagcccagc      5820
     gactatacca atcccggcag ctataccgga ggaaactaca tgaccctctc ggaagatgcc      5880
     ctgggtattc aaaatgctta cgcatacgat gcaaacgtcg gcaacatgat aggacacgcc      5940
     gatcctctaa atcatattac ctggtttaac tatgacacac tgaaccgtct catcagagta      6000
     acagatcctt taaatcgcaa agcctattac cagtacgatc ccgtaagcaa cctgatttat      6060
     acacgcgacc ccaggagcgc gtcgtcatcg gacaacacat acagcacatt ctacgggcca      6120
     aacaacctga accggctttc tgccctgacc gattcacaga accggagcgc cacctatacc      6180
     tatgacagat ccggtaacct gacgggaatt gccctgccca acggccaaag cgaaagcctg      6240
     gaatatgata acgccaaccg cctgagcaaa attacactaa gtgatggcaa atactataac      6300
     tattactatg acggagccgg agaactgatc agcgttacag atcaaaacgg agccggttgc      6360
     tcctggaact acgacggagc acacagagta accggtacaa cagatccatt aggctatcag      6420
     cttaactact ccttagataa aagcggcaat cttgagttgg aatctggtat tgattacagt      6480
     tgccactaca agtatgacgg tggcaataat atatacaaac tatatctacc cggtgcaata      6540
     atctactata atcgcgatgg tcaagggcgt gtttttaacg ttgagtataa cccgtcctac      6600
     attgttaatc accagttgca ttatgctacc agccaaagaa taatcaacta tctggtcaat      6660
     ggctggtgca tcagtatcca ggatcaatac ttcccctatc gatccggtta ctcatacggt      6720
     tactatgctg acggtactat ctccggctac agctcgtgga acggcacaca cagtttcagc      6780
     tatgatgctg acggaaggct tgcctcctgg acacacggag gaattcaaca gaattacaca      6840
     tatgatgccg ccggcaacct cctgaccaaa ggaaacagga catttgccta caacaacatc      6900
     aacgagatca cgagtccggg cttcacctac gatcaaaacg gtaacatgac cggcgacggc      6960
     agcttcaatt atacctacaa cgccttgaat cagctcgtcc gggtcaataa agcatccgac      7020
     gggagtctgg tggccaccta tacctacaac cacgacggca ccaggagaaa taaagtcacc      7080
     gctcaaggaa caaccaacta taactgggat gcctccggga acttaattag ggaaatcggc      7140
     cccaatggta cctattgtta ctactatgtg tcgggcaaac taatcgcctt cgagaataac      7200
     cagcagttgt atatagtgca cgataacctg cggggcgatg tcatcagctt atcaatgacg      7260
     gatgactacg gaaacacaga tcaggaaaac aggtatgact acgacccatg gggcactcct      7320
     atctgtgagg atgaatcggt aaagtcaccc ttccgctacg ccggttatta ctatgatact      7380
     gagacgggat tgtattattt aaagagcagg tattacagcc cggcgttggg gaggtttttg      7440
     acgagggacc cgcatagttt tataaatcat gctgacccac agacgcttaa tttatatgct      7500
     tattgtggga ataatcctgt gagcactgtt gacccaacgg gtcattggga tgaagaaccc      7560
     agtgaaggat atgttgttag cccagattat ttggaaaata ccgcaacagc taggattatt      7620
     aatagtaacg tattccagaa tatattaatg ggaattagtg taggtgaggg attaagagct      7680
     cttaagtttt ttaagggcgc gggtaatttg aaacttactt ctgatgctct taaaaaaatt      7740
     gggacaaagg ctgagagtag tggaattagg gctgtcaaag gaactgctga tgatgcttgg      7800
     gatttcttta ggaatcaggt aaatatatca tcaataaaag aagtgaaacc aggtgttttt      7860
     gttgggaaag acggtaatgg gctgaccttc acatatagag cagcctcaaa gtcaggacca      7920
     ccaacaatag atgttaacgg aatccaaggc ttaaggaaaa taaagttctt gccatag         7977
//

If you have problems or comments...

PBIL Back to PBIL home page