(data stored in ACNUC7421 zone)

EMBL: CP001720.PE151

CP001720.PE151       Location/Qualifiers
FT   CDS_pept        183996..184577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0161"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61116"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2W0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61116.1"
FT                   /translation="MIREITNESQKLKLKTEFLKVFKGIDPFHEVFNDAVVERLIIYPT
FT                   DGYYLTPEQFEALLNAANIVGDSEIYISEVESESDCFTAGESDRKYQCKHWVVENQIQL
FT                   NQYYELPIVLENAIYSPQGKWGIIISHEEHALLGGMNEFMKYFKASYNKWNEDTESFIV
FT                   TWESNKKLYDSNLDWLPKILRHINQNEEII"
     atgatacggg aaataactaa tgaaagtcag aaactaaaat tgaaaaccga atttctaaaa        60
     gtatttaaag gaatagatcc gtttcatgaa gtatttaatg atgccgtcgt tgaaaggctg       120
     ataatctatc caacagatgg atattacctt actccagaac agtttgaagc actattaaat       180
     gccgcaaaca ttgtaggaga tagcgaaata tatatatctg aggtagaatc agaatcggac       240
     tgttttacag caggtgaatc agatagaaaa tatcaatgta aacattgggt agtggaaaat       300
     caaattcaat taaatcaata ctatgagcta ccaatagtat tagagaatgc tatatattcg       360
     cctcaaggca agtggggtat aataatttct catgaggaac atgcactatt aggtggaatg       420
     aatgaattca tgaaatactt caaagcaagt tacaataaat ggaatgaaga tactgaatca       480
     tttattgtaa cctgggagag caacaaaaag ctatatgatt caaacttaga ttggcttcca       540
     aaaatattga ggcatattaa tcagaatgaa gaaataattt ga                          582
//

If you have problems or comments...

PBIL Back to PBIL home page