(data stored in ACNUC7421 zone)

EMBL: CP001720.PE154

CP001720.PE154       Location/Qualifiers
FT   CDS_pept        complement(186582..187214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0164"
FT                   /product="peptidase M56 BlaR1"
FT                   /note="PFAM: peptidase M56 BlaR1; KEGG: swp:swp_3950 TonB"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61119"
FT                   /db_xref="GOA:C8W2W3"
FT                   /db_xref="InterPro:IPR008756"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2W3"
FT                   /inference="protein motif:PFAM:PF05569"
FT                   /protein_id="ACV61119.1"
FT                   /translation="MFDRVFLQILNMSFNASLVIIFVLIARLLLKKAPKIFSYVLWSIV
FT                   LFHLVCPISFKGVWSLLPVNPNPISTDIIYSQNPKITTGLDVIDNTINAVLPAPATLGA
FT                   SINPLQIWIFFGEIIWLIGIAALILYSVATLMLLHKKLIGIHPNIFLPSTLSKRKQNYI
FT                   VLHEQTHIRRFDHIVKIAGFLILAIHWFNPFVWVALILCNRDMEMSL"
     atgtttgata gggtcttttt gcaaatactt aacatgagtt ttaacgcaag cctcgttatc        60
     atatttgtgc taattgcgag attgctgctt aaaaaagctc ctaagatatt ttcctatgta       120
     ttatggagca tagttctgtt tcatcttgtt tgtcctatct catttaaagg tgtatggagt       180
     ttgcttccag tcaatccgaa cccgatttcg acggatataa tttattctca aaatccgaag       240
     attaccacag gattggacgt tattgacaat acgataaacg ctgttctgcc agcaccggca       300
     acactaggtg cgagtataaa ccctttgcag atatggatat tttttggtga aatcatttgg       360
     cttattggta ttgctgcgct cattctttac agtgttgcta cgcttatgtt gttgcacaaa       420
     aaacttattg gaatacatcc gaatatcttt ctgccatcca cactctcgaa acggaaacaa       480
     aactatatcg tactacacga acagacacat atccgacgtt ttgaccatat tgtgaaaatc       540
     gccgggtttc ttatcctagc aattcattgg tttaatccgt ttgtctgggt cgcacttatc       600
     ctttgcaata gggatatgga aatgtccttg tga                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page