(data stored in ACNUC7421 zone)

EMBL: CP001720.PE157

CP001720.PE157       Location/Qualifiers
FT   CDS_pept        188272..189042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0167"
FT                   /product="Sec-independent protein translocase, TatC
FT                   subunit"
FT                   /note="TIGRFAM: Sec-independent protein translocase, TatC
FT                   subunit; PFAM: Sec-independent periplasmic protein
FT                   translocase; KEGG: dal:Dalk_4186 sec-independent protein
FT                   translocase, TatC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61122"
FT                   /db_xref="GOA:C8W2W6"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2W6"
FT                   /inference="protein motif:TFAM:TIGR00945"
FT                   /protein_id="ACV61122.1"
FT                   /translation="MKISEDKELTVVQHLEELRKVLIVSIIATLVMTLVSWFYVEQVLN
FT                   LLLSPVTFSNHRLVYIGVTEAIMTKIKLAFFLGFITALPVTLWQVWSFLVPALRKIEKI
FT                   YFTLFIFLSFLLFVTGLLFGFLVVFDLCVKILLHFGGPELDPMLSIGKYISFTVNFLLP
FT                   FGLIFEMPLASFFLAKLRLINYRVMVKGRKIALLVSIVAASALIASPDIFSVLLMAAPM
FT                   YLLYELSALIVKLVDWKAARKLGRREKELIAAEL"
     gtgaagatat cagaggacaa agagctaacc gtagtccaac acctggagga actgcgaaag        60
     gtgctgatag tgtctattat agccaccctt gttatgaccc tggtcagctg gttttatgtc       120
     gagcaagttt tgaatctctt actctcacct gtaacctttt ccaaccatag gttggtttat       180
     atcggggtta ccgaagcaat catgaccaag attaagctgg ctttctttct aggatttata       240
     actgctttgc ccgttaccct ctggcaggtt tggagttttc ttgtgccggc tttgcgcaaa       300
     atagaaaaaa tctattttac actgtttata tttttatctt tcctgctttt tgtaacgggg       360
     ttgttgttcg gatttctggt agtctttgat ttatgcgtta aaatactgct tcactttggc       420
     gggcctgaat tggatcctat gctgagtatc ggtaaatata tatcctttac tgtgaatttt       480
     cttttgcctt tcggactgat ttttgaaatg cccctggcct ccttcttttt ggccaagtta       540
     aggcttatca actaccgggt tatggttaag ggacgtaaaa tagctcttct ggtttctatc       600
     gtagctgcct cggcactaat agcttctcct gatatttttt ctgtcttgct tatggccgca       660
     ccaatgtatt tactatatga actgagtgcg ttaattgtta aactggtgga ttggaaagca       720
     gcccgcaagc ttgggcggag ggagaaagag ctgatagcag cagaattata a                771
//

If you have problems or comments...

PBIL Back to PBIL home page