(data stored in ACNUC7421 zone)

EMBL: CP001720.PE158

CP001720.PE158       Location/Qualifiers
FT   CDS_pept        189116..190657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0168"
FT                   /product="hydrogenase, Fe-only"
FT                   /EC_number="1.12.7.2"
FT                   /note="KEGG: sat:SYN_01370 iron only hydrogenase large
FT                   subunit; TIGRFAM: hydrogenase, Fe-only; PFAM: hydrogenase
FT                   large subunit domain protein; iron hydrogenase small
FT                   subunit; 4Fe-4S ferredoxin iron- sulfur binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61123"
FT                   /db_xref="GOA:C8W2W7"
FT                   /db_xref="InterPro:IPR003149"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR013352"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036991"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2W7"
FT                   /inference="protein motif:TFAM:TIGR02512"
FT                   /protein_id="ACV61123.1"
FT                   /translation="MDDRFSLEKEITRRSFLKMMGGLGLTGLSLSLAGCGEGQQEFAGG
FT                   KGWMPQQYQVAGAWPAQVRGRVPVSPDNPSIARDDRKCILCGQCLEVCKNTQTVYGHYA
FT                   LPLVNDIVCVNCGQCALWCPTGAISECDDSEKVWEAIQDPGKVVVVQTAPATRVALGEE
FT                   FGLEPGAWVMGQQVAALRRLGFDVIFDTNFTADLTIMEEATELIRRVKGDLKKPLPQFT
FT                   SCCPGWIKFCEYFYPDLFLNLSTCKSPQQMLGALVKTYFAKEKGLNPKNIFSVAIMPCT
FT                   AKKFEANRSEMKDSGYRDVDSVLTTRELSRLLKKHNIDLTKLPAENYDPLMGKSTGGAV
FT                   IFGATGGVMEAAVRTAYFFITQSPPPSGLLQLTPVRGLAGVKEAAVEIPGVGRIRVAVC
FT                   HGMGNAREILEATRKGNAPWHFVEFMCCPGGCQSGGGQPRTAVPPSDEIRLKRIASLYN
FT                   ADAKMVMRESHENPDILTIYQKFLEHPMSELAERLLHTEYISRGKCFSPLKSGAV"
     atggatgacc ggtttagttt agaaaaagaa attaccagac ggtcatttct taaaatgatg        60
     gggggcttgg gcctgaccgg tttatcgcta agtcttgccg gatgcggtga aggccaacag       120
     gaattcgccg gagggaaagg atggatgccg cagcagtatc aggtagccgg tgcctggccg       180
     gctcaggtgc ggggaagggt gccggtcagt ccggacaacc cgtcaatagc ccgtgatgac       240
     cggaaatgta ttctgtgcgg tcagtgtttg gaagtctgta aaaacacaca aaccgtttac       300
     ggtcattatg cgttgccgct ggttaatgac attgtttgtg ttaactgcgg acagtgtgct       360
     ctctggtgtc ccaccggggc gattagcgag tgcgacgata gtgaaaaggt atgggaggca       420
     atacaggatc cgggtaaggt ggtggttgtc cagacagccc cggctaccag ggtggctttg       480
     ggcgaggaat tcggtttgga gccaggtgcc tgggtaatgg ggcagcaggt agccgcttta       540
     agaagactgg gttttgatgt gatttttgat accaatttca cagccgattt gaccattatg       600
     gaagaagcca ccgaactgat caggcgtgtc aagggggact tgaaaaagcc tttgccccag       660
     tttacttcct gctgtcctgg ctggattaag ttttgcgaat acttctaccc ggatctcttt       720
     ttaaatttat ctacctgcaa gtccccgcag cagatgctcg gggcgctggt taaaacttat       780
     tttgccaaag aaaaggggtt aaaccctaaa aatatatttt cagtagctat tatgccttgt       840
     acagctaaaa aatttgaagc caatcggtcg gaaatgaagg acagcggtta ccgggatgtg       900
     gactcggttc ttactaccag ggagttgtcc cgtctgctta aaaaacataa tattgatctg       960
     accaaactgc cggcggagaa ctatgatccg ctgatgggaa agtctaccgg cggggctgtt      1020
     attttcggag ctaccggcgg ggtaatggaa gccgcggtaa ggacagctta tttctttatt      1080
     actcaaagtc cgcctccttc cgggcttctt caactgacac cggtgcgggg cctggcgggt      1140
     gtgaaagaag ccgcggtaga aataccgggt gtgggccgga tcagggttgc cgtttgtcat      1200
     ggcatgggca atgcgcggga aatactggag gccactcgca agggtaacgc cccctggcat      1260
     tttgtggagt ttatgtgctg tccgggcggc tgtcagagcg ggggcggaca gccgcgtact      1320
     gcagtgccgc cttctgatga aattcgttta aaaaggattg ccagtttgta taatgccgat      1380
     gccaaaatgg ttatgaggga aagtcatgaa aacccggata ttttaaccat ctaccagaaa      1440
     tttctggagc atccgatgag tgaactggct gagaggctgc tgcatactga atatatatca      1500
     cggggtaaat gtttcagccc gttaaagtct ggtgcagttt aa                         1542
//

If you have problems or comments...

PBIL Back to PBIL home page