(data stored in ACNUC7421 zone)

EMBL: CP001720.PE161

CP001720.PE161       Location/Qualifiers
FT   CDS_pept        192770..193687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0171"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: tbd:Tbd_2651 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61126"
FT                   /db_xref="GOA:C8W2X0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2X0"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACV61126.1"
FT                   /translation="MNIKQLEAFLQVARHKNFTKAAVHLMMSQPAVSFQIKSLEEDLQI
FT                   NLFERSEKKVALTEAGRLLYPVAMQMVRQYHKIRASLDDLRNLKTGHLQLGACPAAGEI
FT                   LLPRLIGAFREQYPGVKISLQVGGSSQVNRWLKERDVVMGILSIPVQIDGVEGQPWLRD
FT                   HLAFIAPTWHPWNGAEVKPNDLLRESLVIRETGSGSRQVAEQQFLELNLSLEQFAGILE
FT                   LGSNQSIINAVRAGLGIGLVSSWTVRDDIARNNIGVFTVPGLTFEYNLYLAWNQPGAEG
FT                   LAVSTFRRFLLNHEITGRLLDDIS"
     gtgaatatta aacaactgga agcctttctc caggtagcta gacataaaaa ttttactaag        60
     gccgctgttc atttaatgat gagccagccg gcagttagtt ttcaaattaa atcactggag       120
     gaagacctgc aaatcaatct ttttgaacga agtgaaaaaa aggttgcgct tacagaggca       180
     gggaggctgc tttaccccgt ggctatgcaa atggtgcggc agtatcataa gatccgggcc       240
     agcctggatg atttgagaaa cttaaaaacc ggtcatctcc aattgggagc ctgtccggca       300
     gccggtgaaa ttctgctgcc ccggctgata ggagcctttc gggaacaata cccgggtgtt       360
     aagataagcc tgcaggtagg gggcagttct caagtgaacc gctggctcaa ggaacgggat       420
     gtggtaatgg ggattttgag tattccggtg caaatcgacg gtgttgaagg tcaaccctgg       480
     ttgcgcgatc acctggcatt tattgcgcca acctggcatc cttggaatgg cgccgaagtt       540
     aagccgaatg atttgctcag agaatccctg gtgatcaggg aaaccggttc cggctctcgt       600
     caagtagcgg agcagcagtt tctcgaacta aatttatctc ttgaacagtt tgcgggtatt       660
     cttgaacttg gcagcaacca gtctataata aatgctgtgc gggcggggct tggcataggc       720
     ctggtatctt cctggacggt ccgggatgat atagcaagga ataacattgg ggtgtttact       780
     gtaccgggtt taacctttga atacaatctt tatctggcct ggaatcaacc cggagcagaa       840
     ggcttggctg tcagtacttt ccggcggttt ttgctgaatc atgaaattac cggccgtttg       900
     cttgatgaca tttcttaa                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page