(data stored in ACNUC7421 zone)

EMBL: CP001720.PE163

CP001720.PE163       Location/Qualifiers
FT   CDS_pept        complement(195664..197457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0173"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.99.5"
FT                   /note="PFAM: Respiratory-chain NADH dehydrogenase domain 51
FT                   kDa subunit; 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: sfu:Sfum_0845 NADH dehydrogenase (quinone)"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61128"
FT                   /db_xref="GOA:C8W2X2"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2X2"
FT                   /inference="protein motif:PRIAM:1.6.99.5"
FT                   /protein_id="ACV61128.1"
FT                   /translation="MSMYRSHVLVCAGAGCISSDCKAVQSALIANIQAQGLKDEIKVVE
FT                   TGCMGPCDLGPVVLIFPDGVFYRKLKPEDTADIVTEHLLKGKLVDRLLHRPTGKSEQVA
FT                   TFDRMEFFKRQTRVTLRNTGLINPESIEEYIARDGYQALGKVLSKYSPEEVISAIKASG
FT                   LRGRGGAGFPTGLKWEFTARASGNPKYVVCNADEGDPGAFMDRSILEGDPHSVLEAMAI
FT                   CGYAIGAEKGFIYVRAEYPLAVQRLETAIGKCLEYGLLGRNIFSTGFNFDIEIRVGAGA
FT                   FVCGEETALLASIEGRRGEPRPKPPFPAQEGLWGKPTVINNVETWANIPPIILNGPEWF
FT                   SAIGTENSKGTKVFALAGKINNTGLVEVPMGTPLKEIIYDIGGGIPNGKKFKAVQTGGP
FT                   SGGCIPAEYLDTPVDYDSLVKLGTIMGSGGMIIVDEDTCMVDLAKFFLEFVQEESCGKC
FT                   APCRIGTKRMLEIMERIVEGNGKDGDIELLEELSQGIKSSALCGLGQTAPNPVLSTLRH
FT                   FREEYIAHIKDKRCPAGACQALVTYYIDARACKGCGLCSKNCPAGAISGEKKKPHVIDA
FT                   GKCIKCGTCKDKCKFNSIFIL"
     atgagtatgt ataggtcaca tgtacttgtc tgtgccgggg caggctgtat atcctcggac        60
     tgcaaagcag tgcaaagcgc gttaatagcc aatattcaag cacaaggatt gaaagatgaa       120
     ataaaagtcg tggaaaccgg ctgcatggga ccctgtgacc tgggtccggt ggtgctgatt       180
     tttcctgacg gggtttttta ccgcaagctg aaaccggaag atacagctga tatcgttacc       240
     gaacacctgc tcaagggcaa attagttgac cgtcttttgc accggcctac cggaaaatca       300
     gaacaggtcg caacattcga ccggatggaa ttcttcaagc gtcaaaccag agtcaccctg       360
     cgcaacaccg gactgattaa tcctgaatcc atagaagaat acattgccag ggacggctac       420
     caggccttag gcaaagtgtt atcaaaatac tcaccggagg aggttatttc ggctattaaa       480
     gcttccggtc tgaggggcag gggaggggcc ggctttccta caggcttgaa atgggaattt       540
     actgcccggg cctccggaaa tcccaagtat gtggtatgca acgccgatga aggtgatccc       600
     ggcgcgttta tggatcgcag tattctggaa ggggacccgc acagtgtatt ggaggccatg       660
     gctatctgcg gctacgctat cggagcggaa aaaggcttta tttatgtgcg cgcggaatac       720
     ccgctggcag tgcagaggct ggaaacagcc atcggcaaat gcctggaata cggtttgctg       780
     ggccgaaata ttttcagtac cggttttaat tttgatatag aaataagagt aggagcaggc       840
     gcctttgtct gtggtgaaga aacagccctg ctggcttcta ttgaaggccg gcgcggcgaa       900
     cccagaccaa agccgccttt ccctgcacag gagggactct ggggcaaacc cactgtaatt       960
     aataacgttg aaacctgggc caacataccc ccaattattc tcaacggacc tgagtggttc      1020
     agcgctattg ggacagagaa cagcaaaggc actaaggttt ttgccctggc cggcaaaatc      1080
     aacaataccg gactggttga agtgcctatg ggtactcctt taaaggaaat catctatgat      1140
     atcgggggcg gcatacctaa cggcaaaaaa ttcaaagccg tacaaaccgg cggaccctcc      1200
     ggcggctgta tcccggcaga atatctggac actccggtag attatgattc cctggttaaa      1260
     ctgggcacaa ttatgggttc cggcggcatg attattgtag atgaagacac ctgcatggtg      1320
     gatttagcca agtttttcct cgagtttgtt caggaagaat cctgcggcaa atgcgctccc      1380
     tgccgtatag gaacaaaacg catgctggaa ataatggagc gaatcgtcga aggcaacggt      1440
     aaagacggtg atatagaatt gctggaagag ctcagccagg gcattaaaag ctccgcctta      1500
     tgcggactgg gacaaacagc gcccaaccct gttttaagca cgctcaggca ttttcgggaa      1560
     gaatatatag cccatataaa agacaaaaga tgtccggccg gagcctgcca agcactggtt      1620
     acctactata tcgatgcaag ggcctgtaaa ggctgcggtt tgtgcagcaa aaattgccct      1680
     gccggcgcta tcagcgggga aaagaaaaaa ccgcatgtta ttgatgcggg caaatgcatc      1740
     aagtgcggga catgcaaaga caagtgcaag ttcaattcaa tatttatttt atga            1794
//

If you have problems or comments...

PBIL Back to PBIL home page