(data stored in ACNUC7421 zone)

EMBL: CP001720.PE168

CP001720.PE168       Location/Qualifiers
FT   CDS_pept        complement(199343..200674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0178"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; Fe-S cluster domain protein; KEGG: dat:HRM2_16550
FT                   iron-sulfur binding hydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61133"
FT                   /db_xref="GOA:C8W2X7"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2X7"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACV61133.1"
FT                   /translation="MQKYFHSVRLDEDKCKGCTNCVKRCPTEAIRVREGRALIIEERCI
FT                   DCGECIKICPNRAKLATTDGLEQLQNFHYTIALPAPSLYAQFEPNTSPEQILGALLNIG
FT                   FDDIFEVALGAEAVSLALRDYLSRDHPRPMISSACPAVLRLMQVRFPGLLQHIVPIETP
FT                   MEISAGLAREKARQQHGFSDNQIGVFFITPCPAKVTAIKQPFGEKSYVDGAISMSVIYG
FT                   ELLHSLDSPSTKQLPLLSGARGVGWGKAGGENHAIRCHSHLAVDGIHSIINVLEEIERG
FT                   GLSDIDYLEAQACTGGCIGGPLAPQNLFVARVRMDNLVKKLSLQPDRPKSLSTDPEFLR
FT                   LNKPILPRPALKLDQDINRAIEMLEEVEKITEDLPGLDCGSCGSPNCRALAEDIVRGYA
FT                   DTSFCIFKLRQRLQILAREIVDLSHKQPPAMGREREKELKEGDA"
     atgcagaaat attttcactc tgtaagactg gacgaagata agtgcaaagg ctgcaccaat        60
     tgcgtcaaac gctgccccac cgaggctatc cgggtaaggg aaggacgggc tctaattatt       120
     gaagaacgct gtatcgactg cggtgagtgc ataaaaattt gcccgaaccg ggctaaactg       180
     gccacaactg acgggctgga gcagctgcaa aactttcatt acaccatcgc actgcctgct       240
     ccttctcttt atgcgcaatt tgagcctaat accagtcccg aacaaatatt aggcgcactt       300
     ttaaacatag gctttgacga tattttcgaa gtagccctgg gagccgaggc agtttcactg       360
     gctctgagag attaccttag ccgcgatcat ccaaggccca tgatttcttc cgcctgtccg       420
     gccgtactca ggctgatgca ggtgcgtttt cccggactat tgcagcacat agtgccaatc       480
     gagacaccta tggaaatttc agccgggctg gccagggaaa aggcccgtca gcagcatggc       540
     ttcagtgaca accagatagg cgtctttttt ataactccct gcccggccaa agtaactgcc       600
     ataaaacaac cattcgggga aaaatcctat gtggacggcg ctatttcaat gtccgtaatc       660
     tacggcgaac tgctgcatag tcttgattca ccatcaacga aacaattacc tttattatca       720
     ggagccaggg gtgtgggctg gggaaaagcc ggaggagaaa accatgccat caggtgccac       780
     tcacatctgg ctgtagacgg tattcacagt attatcaacg tgctggagga aattgaaaga       840
     ggtggcttaa gcgatataga ttacctggaa gcacaggcct gcaccggcgg ctgtatcggc       900
     ggcccgctgg cgcctcaaaa tctgttcgta gcacgcgttc gcatggataa cctggtcaaa       960
     aagctgagtt tgcaaccgga caggccaaag agtttatcaa cggatccgga gttcttacgc      1020
     ctgaataaac caattttgcc cagacccgcc ctaaaactgg accaggatat taaccgggct      1080
     attgaaatgc tggaagaagt tgaaaagata acggaagatt tacccggtct ggattgcggt      1140
     tcttgcggct ctccaaactg ccgggcactg gcggaggata ttgtcagggg ctacgcggat      1200
     accagcttct gcatcttcaa actccgtcaa aggctgcaga ttttagcccg tgagatagtg      1260
     gacctatccc acaagcagcc cccggccatg ggcagagaga gggaaaaaga acttaaagaa      1320
     ggtgatgcct ga                                                          1332
//

If you have problems or comments...

PBIL Back to PBIL home page