(data stored in ACNUC7421 zone)

EMBL: CP001720.PE169

CP001720.PE169       Location/Qualifiers
FT   CDS_pept        complement(200674..201102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0179"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: dat:HRM2_16560 RsbW2"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61134"
FT                   /db_xref="GOA:C8W2X8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2X8"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACV61134.1"
FT                   /translation="MQLEFEIKGMDFARAGEAAAKIKKALQMVGMEVETIRKTLVVAYE
FT                   AELNVVIHAYAGTLTAKISPDAVEIKVMDEGPGIADIELAMQEGYSTAPSNIREMGFGA
FT                   GMGLPNIERCSDQMELTSEVNQGTLLTAIIFNRTSGEK"
     ttgcagttgg aatttgaaat taagggcatg gactttgccc gggccgggga agcggcagca        60
     aaaataaaaa aagctctgca aatggttggg atggaagtcg aaaccatcag gaaaacctta       120
     gttgtagcct atgaggccga acttaatgta gttattcacg cttatgccgg tacactgact       180
     gcaaaaatca gccctgatgc cgtggagata aaggttatgg atgagggacc gggtatagcc       240
     gatattgaac tggccatgca ggagggttat tccaccgcac cttccaacat cagagaaatg       300
     ggtttcggag cgggtatggg acttcccaat attgagcgct gctcggatca aatggaacta       360
     acctccgaag ttaatcaagg gaccctgctc actgccataa tattcaacag gacaagtggt       420
     gagaaataa                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page