(data stored in ACNUC7421 zone)

EMBL: CP001720.PE17

CP001720.PE17        Location/Qualifiers
FT   CDS_pept        19563..20468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0018"
FT                   /product="Domain of unknown function DUF1848"
FT                   /note="PFAM: Domain of unknown function DUF1848; KEGG:
FT                   ppd:Ppro_0347 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60982"
FT                   /db_xref="InterPro:IPR014998"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVB3"
FT                   /inference="protein motif:PFAM:PF08902"
FT                   /protein_id="ACV60982.1"
FT                   /translation="MILSASRRTDIPCFYSDWFMNRIRAGYVLTRNPMNHAQLSRIPLS
FT                   PEIVDCIVFWTKDAKNIMPHLGVLDGMGYKYCFQFTLTPYNRSLERNLRGKAEIEDTFI
FT                   ALSKQIGKKQIIWRYDPIILNSTLDIAYHRAQFERMCDKLADYTETLIISFVDIYTKLK
FT                   TNLIREITPDEIIKLSKFIGKTAKAYGLSVVACCEKDSLIQYGIEKASCIDKIMLEKVC
FT                   GCKLNILPDKNQRPGCGCMESVDIGAYNTCLNGCVYCYANGNPAVIERRYNSHNPQNEL
FT                   IIGTVADKEKIMERKVKSHR"
     atgattctct ccgcctcgcg aagaacagac ataccgtgtt tttattccga ctggttcatg        60
     aaccgaatca gagccggata tgtcttaaca cgcaatccta tgaatcacgc gcagctttcg       120
     cgtatacccc tctcgcccga aatcgttgac tgcatcgtct tctggacgaa ggacgcaaaa       180
     aacattatgc cgcacctcgg tgtgcttgat ggcatgggtt ataaatactg ttttcagttt       240
     acactgacac cgtataaccg ctcacttgag cgaaatctgc gcggcaaagc cgaaattgag       300
     gataccttca ttgcactgtc aaagcaaata ggcaaaaaac aaattatatg gcgttatgat       360
     ccgataatac tcaacagcac gctggatatt gcataccata gggcgcagtt tgagcggatg       420
     tgcgacaaac ttgcggacta tacagaaaca ttgataatca gctttgttga catttatact       480
     aagttgaaaa caaatttaat tcgcgaaatt actccagatg aaatcatcaa attgagcaaa       540
     ttcattggca aaactgcaaa agcctatgga ttgagcgttg ttgcctgctg tgagaaagac       600
     agtcttatac aatacggcat agaaaaagcg agctgtattg ataaaataat gctcgaaaaa       660
     gtctgcgggt gcaaacttaa cattttgcct gacaaaaatc aacgccccgg ttgcgggtgt       720
     atggagagcg ttgatatcgg tgcatacaac acatgcttaa acggctgtgt gtactgctac       780
     gcaaatggca atcctgccgt tattgagcgt cggtataatt cgcacaatcc tcaaaatgaa       840
     ctgataatcg gtacggttgc tgacaaggaa aagattatgg aaagaaaggt taaatcgcac       900
     aggtga                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page