(data stored in ACNUC7421 zone)

EMBL: CP001720.PE173

CP001720.PE173       Location/Qualifiers
FT   CDS_pept        complement(204452..205678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0183"
FT                   /product="small GTP-binding protein"
FT                   /note="TIGRFAM: small GTP-binding protein; PFAM:
FT                   GTP-binding protein HSR1-related; Miro domain protein;
FT                   KEGG: sfu:Sfum_1843 small GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61138"
FT                   /db_xref="GOA:C8W2Y2"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR023873"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040644"
FT                   /db_xref="InterPro:IPR041606"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Y2"
FT                   /inference="protein motif:TFAM:TIGR00231"
FT                   /protein_id="ACV61138.1"
FT                   /translation="MHETPRGTRLHIALFGRRNAGKSSLINALTRQNLAIVSNVAGTTT
FT                   DPVYKSMEILPIGPVVLIDTAGLDDEGELGQKRVAKSMAVLAKTDLVLLVADVQKGLGK
FT                   TELELIETARKKELPVIGVANKIDLLPQPEEISFPLPDMTWVKVSALTGKGINELKQAM
FT                   VKLAPKEWVAPTIAGDLVPPGELAMLVVPIDLAAPRGRLILPQVQTIRDLLDNDCLTMV
FT                   VKERELKAAFGVLRKPPRLVITDSQAFLKVDADTPPGVLMTSFSILFARYKGDLATLVE
FT                   GALAVEELQPGDKVLIAEACTHHQVADDIGTVKIPRWLRQIVGGELHFSWSSGLELPSD
FT                   LSGYKLIVHCGGCMINRREMLSRIMTAQAAGVPIVNYGVLIAYVHGILRRALAPFPDVL
FT                   RLYENKEMT"
     atgcacgaga cacctagagg caccagactg catatcgccc tgttcggacg gcgtaatgcc        60
     ggcaaatcca gcctgattaa tgcactgacc aggcaaaatc tggccattgt ttccaacgtg       120
     gccggcacta ctaccgaccc tgtatacaaa tcaatggaaa ttctgcccat cgggcctgta       180
     gtattgattg atacggcagg actggatgat gaaggagaac tgggacaaaa aagggtggcc       240
     aagagtatgg ccgtgctggc taaaactgat ctggtactgc tggtagcaga tgtgcaaaaa       300
     ggtttaggaa aaaccgaact ggaattaata gaaactgccc gaaaaaagga acttccggta       360
     attggcgttg ccaataaaat cgatcttttg cctcagccgg aggaaatatc tttcccactg       420
     ccggatatga cctgggttaa agtcagtgct ctgaccggaa aaggtattaa tgaacttaaa       480
     caggctatgg ttaaactggc tcccaaggaa tgggtagctc ctactattgc cggagatctt       540
     gtgcctcccg gtgaactggc catgctggta gtgcctatag acctggcagc acccagaggg       600
     cgtttgatct tgccgcaggt acaaactatc cgtgacttgt tagataacga ctgcttgact       660
     atggtagtca aagaaaggga actaaaagca gccttcggcg tgctgcggaa gcccccccgg       720
     ttggtaatca ctgattcaca agccttctta aaagtcgatg cggatacacc gcccggcgtg       780
     cttatgacgt ccttttccat tctttttgcc cgttataaag gggatctggc cacattggtg       840
     gaaggcgcgc tggccgtaga agaactgcag cccggcgata aagtgctgat tgccgaggca       900
     tgcactcacc accaggttgc ggatgatatc ggtaccgtaa aaattccccg ctggctgcgc       960
     cagattgtag gaggggaatt acatttctct tggtccagcg ggcttgaatt gccgtctgac      1020
     ttatccggct ataaattaat tgtacattgc ggcggctgta tgattaaccg cagggagatg      1080
     ctcagccgca ttatgacggc acaggcagcc ggagtaccca ttgtcaatta cggggtttta      1140
     atagcttatg tacacggtat tttacggcgg gcgctggctc ctttcccgga tgtattgagg      1200
     ttatacgaaa acaaggaaat gacataa                                          1227
//

If you have problems or comments...

PBIL Back to PBIL home page