(data stored in ACNUC7421 zone)

EMBL: CP001720.PE174

CP001720.PE174       Location/Qualifiers
FT   CDS_pept        complement(205662..207128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0184"
FT                   /product="fumarate lyase"
FT                   /note="PFAM: fumarate lyase; KEGG: sfu:Sfum_1842 aspartate
FT                   ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61139"
FT                   /db_xref="GOA:C8W2Y3"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Y3"
FT                   /inference="protein motif:PFAM:PF00206"
FT                   /protein_id="ACV61139.1"
FT                   /translation="MTNYRVEKDLLGELKLPRAAYYGINSLRASQNFAVSGYGVNKHLL
FT                   RALAEVKLAAAQANLQASLLPAETARAICSAAQEVAEGGLAEQFIVDALQGGAGTSTNM
FT                   NMNEVLANRAIELLGGQKGDYDLVHPLNKVNLSQSTNDTYPTALRIAAIRLVLDLSEAL
FT                   AELQTSLQEKEAQFAGILKLGRTELQDALPITLGQEFGAFAEAIARDRWRLYKVEERLR
FT                   QINLGGTAIGTGLNAPRRYIYQVVEELRQITGLGLARAENMVDLTQNADIFAEVSGLVK
FT                   AAAVNLCKIAGDLMLLAAGPAGGLAEINLPPRQAGSSIMPGKVNPVILEAVIQVSWQVM
FT                   GADQTICQACAGGRLELNAFLPLIAHNLLHVLEMLAKTARVLNSECIRGITANEERCRR
FT                   WLEESNVLVTALVPYIGYEQATSLAQQAREENKTIVELVQARNLLTIEECQIIAAPREL
FT                   TRPGIAGARQLANRFKKANSQGDGKNARDT"
     atgacaaatt accgagtaga aaaagacttg cttggtgagc ttaagctgcc gcgagcggct        60
     tattacggca ttaactcttt aagagccagt caaaactttg ctgtcagcgg ctacggagta       120
     aataaacact tactccgtgc tctggctgaa gtcaagttgg ccgcagcaca ggcaaatctt       180
     caggccagcc ttttgccggc agaaacagcc agggccatct gctcagccgc acaggaagtg       240
     gctgagggcg ggctggctga acagtttatt gtggatgccc tgcagggagg tgccggcact       300
     tcaacaaaca tgaatatgaa tgaggtgctg gccaaccggg ctattgaact tctgggcgga       360
     caaaaaggag attatgatct tgttcacccc ttaaacaagg ttaacctctc ccaatccacc       420
     aacgatactt atcccacggc actgcgtatc gcagccatcc ggctggtgct ggatttaagc       480
     gaagctctgg ccgagctgca gacaagcctg caggaaaaag aagcgcaatt tgccggaata       540
     ctaaaactcg gacgaaccga actgcaggac gccctgccca ttaccctggg gcaggagttc       600
     ggggcttttg ccgaggctat agcccgtgac aggtggcggt tatacaaggt cgaggaacgg       660
     ctgcgccaaa tcaacttggg cggtacggcc atcggtaccg gtctcaacgc cccgcgccgc       720
     tatatctacc aggtagtgga ggaactgcgt caaatcaccg ggttgggatt ggcccgtgca       780
     gaaaatatgg ttgaccttac ccagaatgct gacatattcg ccgaggtctc cggtctggtc       840
     aaagctgccg ccgtcaatct atgcaaaatt gccggggatc tgatgctgct ggctgccggc       900
     cctgccggag gtttggctga aatcaatctg cccccccgcc aggctggttc ttccattatg       960
     ccgggaaaag ttaacccggt tatcctggaa gcggttatcc aggtgtcctg gcaggtcatg      1020
     ggggctgatc agacaatttg ccaggcctgc gccggaggcc ggctggaatt aaatgccttt      1080
     ttacccttaa tagcccacaa cctgctgcat gttcttgaga tgctggccaa aacagcaaga      1140
     gttctgaaca gcgagtgcat aagaggcata actgccaatg aagaacgttg ccgcaggtgg      1200
     ctggaagaaa gcaatgtact ggttaccgct ctggttccct atataggtta tgaacaggct      1260
     acctccctgg cacagcaagc cagggaagaa aataaaacca tagtagagtt ggtacaggcc      1320
     cgcaatctgc taactataga agagtgtcag attatcgccg caccgcgcga gttgaccaga      1380
     cccggtatag ccggtgcacg ccagctggcc aatcgcttta aaaaggccaa cagtcaagga      1440
     gatggaaaaa atgcacgaga cacctag                                          1467
//

If you have problems or comments...

PBIL Back to PBIL home page