(data stored in ACNUC7421 zone)

EMBL: CP001720.PE175

CP001720.PE175       Location/Qualifiers
FT   CDS_pept        207898..209130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0186"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   transposase IS605 OrfB; KEGG: acr:Acry_3575 IS605 family
FT                   transposase OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61140"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Y4"
FT                   /inference="protein motif:TFAM:TIGR01766"
FT                   /protein_id="ACV61140.1"
FT                   /translation="MSKCKNNQSKKSKSKGIDILVNKFPVYLTPEQTSLARTLQREAAK
FT                   VWNTTCIVHRTIYIKHHCWLDEGAMKAFVKGKYGVHSQSAQAIVETYFECCERTRKLRE
FT                   QGVTDWRYPHRRKRFFTVTWKPLGINYEGKMLTLSNGRGRESLILNLPKRLSGAVIKLV
FT                   QLVWHRNLYWLHVTVEKPALKKVQGGVTAAIDPGEVHAVAITDGKKSLVVSGRLLRSLH
FT                   RLRNKVLRRLQKAISKTKKGSKQRNKLLAAKYRFLNNIERRIEHVIHTISTIVSKWCFE
FT                   HNVNTVYIGNPEGVRKKDCGKKHNQRMSQWTFGKLRRMLEYKLKRHGIKLISVDERGTS
FT                   GTCPACAEYTKQTGRTYKCGKCGFAGPHRDMVGASGILDKSVNGKFTKGRKLPEKVEYA
FT                   RLKVLALKKTA"
     gtgagcaaat gtaaaaataa ccaatcaaag aagtcaaagt caaaaggcat cgacattttg        60
     gtgaataaat ttcctgtata cctaaccccg gagcaaactt ccctggcccg taccctgcaa       120
     agagaggcag ccaaagtatg gaacacaact tgcattgttc accgtacaat ctatataaaa       180
     catcactgct ggctcgacga aggtgccatg aaagcattcg ttaaaggcaa atacggtgtt       240
     cattcccagt cggcgcaggc tatagtggaa acttactttg agtgctgtga gcgcaccagg       300
     aagctgcgcg aacaaggggt tacagattgg cgctatcccc atcgcaggaa acgttttttc       360
     actgtaacct ggaagccact tggtataaat tacgaaggaa agatgctgac tctctcaaac       420
     ggacgcggca gggaatcact catacttaac ttacccaaaa ggctctccgg agccgtcatt       480
     aagctggttc aacttgtatg gcaccgtaac ctttactggc tgcatgtaac ggtagaaaaa       540
     ccggccttga aaaaagtaca gggcggcgtt acagcagcca ttgaccccgg tgaggtacat       600
     gctgtagcta tcacagacgg taagaaatct ttggtagtga gcggcagatt gctgcgttct       660
     ctgcaccggc tcaggaataa ggtgctgcgc aggttgcaaa aagctatttc taaaactaaa       720
     aaaggctcaa aacagcgcaa taagctttta gctgcaaagt accggttttt gaacaatatt       780
     gagcgccgaa ttgagcacgt catacatacc atttcaacta ttgtttcaaa atggtgcttt       840
     gagcataacg tcaataccgt ctatatcggc aatccagaag gcgtgcgcaa gaaagactgc       900
     ggtaaaaagc acaaccagcg gatgagtcaa tggactttcg gtaaattacg caggatgctg       960
     gagtataagt taaagcgtca tggcattaag ctgatatcag tggatgaacg cggtacttcg      1020
     ggtacttgtc cagcttgtgc agagtatacc aagcaaacag gtcgcaccta taaatgcggc      1080
     aagtgtggtt tcgccggccc gcaccgggat atggtcggtg cttccggaat tctggataaa      1140
     tcggttaacg gtaaattcac caaaggccgt aagttacctg agaaggtcga atatgcacgg      1200
     ctgaaggtgt tggcactgaa aaaaactgct taa                                   1233
//

If you have problems or comments...

PBIL Back to PBIL home page