(data stored in ACNUC7421 zone)

EMBL: CP001720.PE177

CP001720.PE177       Location/Qualifiers
FT   CDS_pept        210630..210809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0189"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61142"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Y6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61142.1"
FT                   /translation="MQKDIPITVKLDNHFHILLFTGDKKISDMLVFLMYRKLKQLTSQE
FT                   VEEKARQLNQKTGG"
     atgcagaaag atatcccgat aacagtaaaa ttagacaatc attttcatat tttactcttc        60
     acaggagata aaaaaatcag tgacatgctc gtttttttaa tgtatcgaaa gttaaagcaa       120
     ttaacaagtc aagaagttga ggaaaaggcc aggcagttaa atcaaaagac cggtggttag       180
//

If you have problems or comments...

PBIL Back to PBIL home page