(data stored in ACNUC7421 zone)

EMBL: CP001720.PE179

CP001720.PE179       Location/Qualifiers
FT   CDS_pept        212510..213058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0191"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dat:HRM2_43210 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61144"
FT                   /db_xref="GOA:C8W2Y8"
FT                   /db_xref="InterPro:IPR001850"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Y8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61144.1"
FT                   /translation="MSDRIGVLHRFIPLVRGEEISDCQVAQNMARSLNRLMQIFKPNYG
FT                   VRLYKRQSTENVVDCALCKPDNPEFISPEIYEIGKITGLEQVSPGISVEKSGRTSGLTS
FT                   GRVSAVGVTLQVQISETEIGWFSEQVVCDMNSQPGDSGSLIVNNNKKAVGLLFAGSDKF
FT                   TIFSPIENVCKNLGVELVY"
     atgtctgatc gaatcggggt gctgcatcgt tttattccct tggttagagg tgaagaaata        60
     tccgattgcc aggtggcgca aaatatggcc agaagcctca atcgcctgat gcaaattttt       120
     aaaccaaatt atggggtacg cttgtataaa aggcaaagca cagaaaatgt ggttgattgt       180
     gctctttgca aaccggataa ccctgaattt atttcaccgg aaatatatga gataggtaaa       240
     ataaccggct tggagcaggt aagtcccggc atctcggtgg agaaaagcgg cagaaccagt       300
     ggattaacca gcggcagggt aagtgctgta ggagtaacat tacaggtgca aatatctgag       360
     acagaaatcg gctggttttc tgagcaggta gtctgtgata tgaactcgca gccaggtgac       420
     agcggttctc tgattgtaaa taacaataaa aaggctgttg ggttgctttt tgccggttcg       480
     gataagttca caatttttag cccaatagaa aatgtgtgca aaaatttagg tgttgaactt       540
     gtttactaa                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page