(data stored in ACNUC7421 zone)

EMBL: CP001720.PE18

CP001720.PE18        Location/Qualifiers
FT   CDS_pept        complement(20864..21844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0019"
FT                   /product="DNA binding domain protein, excisionase family"
FT                   /note="TIGRFAM: DNA binding domain protein, excisionase
FT                   family; KEGG: xau:Xaut_3952 DNA binding domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60983"
FT                   /db_xref="GOA:C8VVB4"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVB4"
FT                   /inference="protein motif:TFAM:TIGR01764"
FT                   /protein_id="ACV60983.1"
FT                   /translation="MSKEEVSLTPEEVSGILKIAKNTVYELIKRGELPAYRVGRKIRVD
FT                   LKDVENYKKQGKINELLSESHIPQHQKITGNLAAKKGFFTDEIIPASQELVVCGQDVLL
FT                   DILARYLDRHPNGARSFRHHVGSFPGLLALYQGKAHLAAIHLWDGEKDIYNIPYVRHLM
FT                   PGTPAVIIHLACRMQGFYVARNNPKHIKDWHDLIRTDIVFINRERGSGTRVLLDEHLHR
FT                   LKLDRQLINGYDKEDYSHLAMASAVARGEADLALGNEKVSLQVRGIDFIPLQKERYEMV
FT                   IRKENMEKPLFQAVLEIIRSSEFKSELQGLGDYDLNETGLIVAEV"
     ttgagcaaag aagaagtttc cctaaccccc gaagaagtct caggcatatt aaaaattgca        60
     aaaaataccg tatatgagtt gattaaacga ggcgaacttc ctgcttaccg ggtgggaaga       120
     aaaattagag tggatttaaa ggatgttgaa aattataaaa agcagggtaa aataaatgaa       180
     ttgctgtcag aaagtcatat cccgcaacat caaaaaatta ccggcaatct agcagctaaa       240
     aaggggtttt tcaccgatga aattattcct gcatctcaag agttagtcgt gtgcggtcaa       300
     gatgtgcttc ttgatatttt agcccgttac ctggatcgcc accccaatgg agcacgcagt       360
     ttccgtcatc atgtaggaag ttttcccggt cttttagctc tctatcaggg taaggctcat       420
     ttagccgcaa tacatctatg ggatggtgaa aaagatattt ataatattcc ttatgtgcgt       480
     catttaatgc ctggcacacc ggcggtaata attcacttag cttgtcgcat gcaaggtttt       540
     tatgtagctc gaaacaatcc caaacatatt aaagattggc atgatttaat tcgaacagat       600
     atagttttta tcaacagaga aagaggcagc ggcacaagag ttcttttaga cgaacatctt       660
     cacaggttga aattggacag gcaattaatt aacggttatg ataaagaaga ttattcccat       720
     ttggccatgg ctagtgctgt tgccagaggc gaagctgatt tggctttagg taacgaaaaa       780
     gtatcattac aggtaagggg tattgatttt attcctttac aaaaggaacg ttatgaaatg       840
     gtcataagaa aagaaaacat ggaaaaaccc ctgtttcaag cagtccttga gataatcaga       900
     tcctctgaat ttaaatcaga actacagggg ttgggtgact atgacttaaa cgaaaccggg       960
     cttattgtgg cagaagtata a                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page