(data stored in ACNUC7421 zone)

EMBL: CP001720.PE181

CP001720.PE181       Location/Qualifiers
FT   CDS_pept        213561..215171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0193"
FT                   /product="Peptidoglycan-binding LysM"
FT                   /note="PFAM: Peptidoglycan-binding LysM; SMART:
FT                   Peptidoglycan-binding LysM; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61146"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR024300"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Z0"
FT                   /inference="protein motif:PFAM:PF01476"
FT                   /protein_id="ACV61146.1"
FT                   /translation="MSKKSGAMRNYMDCNYETEYLKINMIIAEDTKQTIVKGKVSVPDP
FT                   KPDVEQILSVEKSARVRRIEVLPDKVVVHGSLNLQIVYVARKPDQSVHSMHHMLTFTTF
FT                   IDLPGVEPDMDVDVKLEVEDVNVKQRHDCNCDRDFDVVAVIKVDAKATQPEELNVVVKV
FT                   HDNNAIIESERLKVDHLIGNARKQIMVDEVFRIPDPKPDIEQIINVDAEVTITHKKIIR
FT                   NKVMFDGEVHLQVLYVARKPDQPVHELHKVIKFSDFVEVPGAGKHMKVEIKTTVESVNV
FT                   DPVKGNPRRLDAGIVLEVKVNVTDPRTVYVVTDVKDSNCKATKYNLRVDQLVGEASTQV
FT                   VVESTSAPPDPKPCAEKILECRVEHIDIEKVEVLSDKVVIRGTLEVKVIYVAMKPNQSV
FT                   HAMHKKMSFRTFVEVPGARKDMDVSVMPMVEFVKAETRGPKVYCEAVIKILVRVTESMD
FT                   QSVVIALDMSEEPEEEPESPVCKPGDMISYTIKSGDTFYKLAMQYDIPLQDLLDANPNV
FT                   NPNNLRVGQVINIPCVAKG"
     atgtctaaga agagcggagc tatgcgcaat tatatggatt gtaattatga aacagagtat        60
     ttaaaaatca atatgattat agctgaggat acaaaacaga ctatagtaaa aggaaaagtg       120
     agtgttcctg atcctaagcc tgatgttgaa caaatacttt ctgtagaaaa gtcagcgaga       180
     gtgagaagaa tagaagtgct gccggataaa gttgtagtgc atggttcttt aaatttgcag       240
     atagtttatg ttgctcggaa acccgatcag tctgtgcatt ccatgcacca tatgcttact       300
     tttacaactt ttatagatct gccgggtgtc gaaccggata tggatgttga tgtcaagctg       360
     gaggtagagg atgtcaatgt aaaacaaaga catgattgta attgtgacag agattttgat       420
     gttgtagcag taattaaagt tgacgccaaa gctacccagc ctgaagaact caatgtagta       480
     gtaaaggtac atgataacaa tgctataatt gaatcagaaa gattaaaggt agatcattta       540
     atcggcaatg caagaaaaca gattatggtt gatgaggtat ttcgaattcc tgatcccaag       600
     cccgatatag agcaaattat aaatgtggat gccgaggtaa ctatcacaca taaaaaaatt       660
     attagaaaca aggtaatgtt tgacggggaa gttcatttgc aggtattgta tgtagccaga       720
     aaacctgatc aaccggtgca tgaactgcat aaagtcatta aattcagtga ttttgtagaa       780
     gtacccggtg ccggtaaaca catgaaggtt gaaattaaaa cgactgtgga aagcgtaaat       840
     gttgatcctg tcaagggaaa tcccaggcgg ctcgatgccg gaatagtgtt ggaagtaaag       900
     gtaaatgtta ccgatcctag aacggtttat gtggtaactg atgtaaaaga cagtaattgt       960
     aaggcaacta aatataattt aagagttgat caattagttg gtgaagcaag tacccaggtg      1020
     gttgtagaaa gcacctcagc acctccggat cccaaaccgt gcgcggagaa aattttggaa      1080
     tgccgcgtcg agcatatcga catagaaaaa gtggaagttc tttctgataa agttgttata      1140
     cggggtaccc tggaagttaa ggttatttat gtagcgatga aacctaatca gtctgttcat      1200
     gccatgcaca agaagatgag tttcagaacc tttgtagagg tgcctggtgc cagaaaagat      1260
     atggatgtct ctgtaatgcc tatggtagag ttcgttaagg ctgaaaccag aggcccgaaa      1320
     gtatattgtg aagccgtaat aaagatctta gtaagagtaa cagaaagcat ggaccaatca      1380
     gtagtcattg ccttagatat gagcgaagaa ccggaagaag agccggaaag ccccgtctgt      1440
     aaaccaggtg atatgatttc ttatactatc aagtccggcg atacctttta taagctggct      1500
     atgcagtatg atatcccctt gcaagactta ttggacgcaa atcccaacgt aaacccaaat      1560
     aatttgcggg taggtcaggt tataaatatt ccctgtgttg ctaaaggtta g               1611
//

If you have problems or comments...

PBIL Back to PBIL home page