(data stored in ACNUC7421 zone)

EMBL: CP001720.PE182

CP001720.PE182       Location/Qualifiers
FT   CDS_pept        215587..216327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0194"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61147"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Z1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61147.1"
FT                   /translation="MLSGQDQLYDMHKTLSRLLDVQSKQGSDQNSLVMLSLVNLMGIID
FT                   ILNKRVQASPAAGVSGNLPLDLSSLQTMLGPLLNIFAKQGQGDCKTQPVERNISPNTDQ
FT                   GCVKNNASMKNSVLESANDQSNKSANQDIKPRVVNPLGGLLNLLGGGGSQPNLVPLLAL
FT                   LGLCGGANQPVLTSLLSLLNNQSNQKADIGALVSLISGLAGSHQAAAQNKVTANKAESP
FT                   SAGEARGEESCREEKNKIIVKKGI"
     ttgttgtccg gtcaagacca gttgtatgat atgcataaaa ctcttagccg gttgctggat        60
     gtacaaagta aacagggttc ggatcaaaat tcattagtaa tgttgagtct ggtaaatctt       120
     atgggtatta ttgatatttt gaacaagaga gttcaagcct cgccggcggc gggagtttcc       180
     ggcaatttgc ctctggatct gtcctcactg cagaccatgc ttggcccgct tttaaatata       240
     tttgccaaac agggtcaggg tgactgtaag acacagccgg ttgagcgcaa cattagcccg       300
     aatactgatc agggttgtgt caaaaataat gcttccatga aaaactccgt tcttgaaagt       360
     gctaatgacc agtctaataa atctgccaat caggatatta aacccagagt cgttaatcct       420
     ttaggcggtt tgttaaattt actggggggg ggtggcagtc aacctaattt agtgcctctt       480
     ctggcactat tggggttatg cggtggggca aaccagcctg ttttaacatc actgttatcc       540
     ttactgaaca accagtcaaa tcaaaaagct gatataggtg cattagtgag tctaatcagt       600
     ggattagcgg gctcccacca ggctgcggct cagaataagg ttaccgctaa taaagctgag       660
     agcccctcag cgggagaggc tcggggagag gaaagctgtc gggaagaaaa aaataaaatt       720
     atagttaaaa aaggtatcta a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page