(data stored in ACNUC7421 zone)

EMBL: CP001720.PE183

CP001720.PE183       Location/Qualifiers
FT   CDS_pept        216357..216659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0195"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   sfu:Sfum_2790 conserved hypothetical protein 103"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61148"
FT                   /db_xref="GOA:C8W2Z2"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Z2"
FT                   /inference="protein motif:PFAM:PF02575"
FT                   /protein_id="ACV61148.1"
FT                   /translation="MLENLSGVIGDIQKVQEKLKQMTVEAGTEKGTVRVVLNGNQEIME
FT                   FYLDRDYLRKTPAEEIQNIIADVFGRAIKESKQMVKDEALKISNNLGLPNIPGLT"
     ttgctggaga atttgagcgg agtaataggt gatatacaaa aagtccagga aaaactgaaa        60
     cagatgactg tagaagcagg cacggaaaaa ggtactgtcc gggttgtatt aaacggaaat       120
     caggaaatta tggagtttta tctggaccgg gattacctgc gcaagacccc ggctgaggaa       180
     atccaaaata ttatagccga tgtttttggc agggcaataa aggaatctaa gcaaatggtt       240
     aaagatgagg cattgaaaat ctcgaacaat ctgggtttgc ctaatattcc cggattaact       300
     tag                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page