(data stored in ACNUC7421 zone)

EMBL: CP001720.PE184

CP001720.PE184       Location/Qualifiers
FT   CDS_pept        216700..217200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0196"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61149"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Z3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61149.1"
FT                   /translation="MDAHNFPKNEGVKETLTFLMDKQALPGSDQEANLLLICLVSLLSI
FT                   VDILQKQMINEIASAAVSSQPGSGFSNRSGKGERVSVAELKTERKAESKNKAVSEQEYK
FT                   RTAASDHFVKEQVSQEQTPGDGNSSVNDKIVNKVKNKTGDTTSKIIKWDSMLKKKVKEP
FT                   LSV"
     gtggatgctc ataactttcc taaaaatgag ggagtcaaag aaaccctgac ttttttgatg        60
     gataagcaag cgctgccggg cagtgatcaa gaagccaacc tgcttttaat ctgcttggtc       120
     agcctgctgt caattgtaga tattttgcaa aaacaaatga ttaatgagat tgcatctgct       180
     gcagtttctt cacaacccgg atccggtttt agcaatagaa gcggaaaagg cgaacgtgtc       240
     agtgttgctg agttaaaaac ggaaagaaaa gcggaaagta aaaataaagc cgtcagtgag       300
     caggaatata aaagaactgc cgcaagtgat cattttgtta aggagcaggt ttctcaggag       360
     caaactcctg gtgacggcaa tagtagtgtt aatgataaaa tagttaataa ggtgaaaaat       420
     aaaacaggcg acacaacctc caagattatt aagtgggact ccatgcttaa aaagaaagta       480
     aaagagccgt tgtctgtata a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page