(data stored in ACNUC7421 zone)

EMBL: CP001720.PE185

CP001720.PE185       Location/Qualifiers
FT   CDS_pept        complement(217221..217601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0197"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: bsu:BSU18610 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61150"
FT                   /db_xref="GOA:C8W2Z4"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Z4"
FT                   /inference="similar to AA sequence:KEGG:BSU18610"
FT                   /protein_id="ACV61150.1"
FT                   /translation="MDHVNTDTQEAAKAARDIKTIIEEVQNSSNKAENIMLLSSDNVSS
FT                   GTKTVNEAGTQFIDIIEHIEKLTQQVLQVAAAAEQMTIGVQNVAAATQQQTASMQEVSS
FT                   SAEDLNLVANELLTMSGQFKMQ"
     gtggatcatg taaacaccga tacccaggaa gcggcaaaag ctgcccggga tatcaaaact        60
     attattgaag aagtgcaaaa ttcctctaat aaagcggaaa atatcatgct gctcagttcg       120
     gataatgtca gctcaggaac caaaacagtg aacgaagccg gtactcagtt tatcgatatc       180
     attgagcata ttgaaaaact tacgcaacaa gtactccagg tagcagccgc tgcagagcag       240
     atgaccatag gcgtgcaaaa cgttgccgct gctacacaac agcaaactgc ctccatgcag       300
     gaagtaagtt catcagcgga agatttgaac ctggtagcca atgagctttt aactatgtcc       360
     ggccagttta aaatgcaata a                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page