(data stored in ACNUC7421 zone)

EMBL: CP001720.PE186

CP001720.PE186       Location/Qualifiers
FT   CDS_pept        217746..218192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0198"
FT                   /product="protein of unknown function DUF606"
FT                   /note="PFAM: protein of unknown function DUF606; KEGG:
FT                   ppd:Ppro_0036 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61151"
FT                   /db_xref="GOA:C8W2Z5"
FT                   /db_xref="InterPro:IPR006750"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Z5"
FT                   /inference="protein motif:PFAM:PF04657"
FT                   /protein_id="ACV61151.1"
FT                   /translation="MSARLVVLLIAASSGLLMALQGSLNASQSKIIGLWETTFIVHLLG
FT                   LVLSALLLFIFKLGSITWANLAQAPWYTYLGGILGVLIIYIVARSMPKVGVAPATTAII
FT                   LGQVFTAGLIDHLGLFGLQKIPFSWLNIVGTFLMAGGAWLILKQ"
     atgagtgcca ggttagttgt tttgcttatt gccgcttctt ccggtttgct tatggctcta        60
     cagggttctc ttaatgcttc tcagagtaaa atcataggtt tatgggaaac aactttcatt       120
     gttcatttat tgggtttagt tttgtctgcc ttactgttat ttatttttaa gctgggttct       180
     ataacctggg ctaatttggc ccaggctccc tggtatacat atttaggcgg tattttaggt       240
     gttttgatta tttacattgt ggccagaagc atgcctaagg ttggggtagc gccggctaca       300
     acagcaatta tcctggggca ggtttttact gccggtttga ttgatcattt aggattattc       360
     ggccttcaga aaataccctt tagctggctt aatattgttg gtacattttt aatggcagga       420
     ggtgcctggt taattcttaa acaataa                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page