(data stored in ACNUC7421 zone)

EMBL: CP001720.PE187

CP001720.PE187       Location/Qualifiers
FT   CDS_pept        complement(218196..218915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0199"
FT                   /product="zinc/iron permease"
FT                   /note="PFAM: zinc/iron permease; KEGG: mca:MCA2417 ZIP zinc
FT                   transporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61152"
FT                   /db_xref="GOA:C8W2Z6"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Z6"
FT                   /inference="protein motif:PFAM:PF02535"
FT                   /protein_id="ACV61152.1"
FT                   /translation="MAEIMILSLIAGLGTCLGAALVITFGQINSKSLSVFLGLACGVMI
FT                   AVILFDLLPAAYFYGNIFSCLGGFCGGLLLLLLLELLTCNRQPATNSYYGHLRTGYLIA
FT                   LGIALHDFPEGLAIAAGFATASKLGPALVLAIGLHNIPEGMATAAPLWLGKQSAKRIIG
FT                   INLLVSLVTPAGTLAGLWLLQLADYFISILLSFAAGAMTYIVFAKLFPESFNQHRRLAL
FT                   TGGFCGMLFFLLLSLLE"
     ttggcagaaa taatgatcct tagcctgata gccggtttag gcacctgcct gggagccgct        60
     ctggtaatta catttggcca gatcaacagc aagtctctct ctgtttttct cggtctggcc       120
     tgcggagtaa tgatcgcagt tattcttttt gatctgctgc cggcagctta tttttacgga       180
     aatatcttca gctgtcttgg cggcttctgc ggggggctcc tgctattgct gttactggag       240
     ttgctcactt gcaaccggca gcctgcaacc aattcctatt acgggcacct aagaaccggc       300
     tatctaatag ccctaggcat tgccctgcat gattttcctg aggggctggc tatcgcggcc       360
     ggttttgcta ccgcaagcaa actcggccca gccctggtac tggccatagg attgcacaat       420
     attccggagg gcatggctac cgccgctcca ttatggttgg gcaaacaatc agccaaacgt       480
     ataatcggca ttaacttgct ggtcagcctg gtgacacctg ccgggacact ggcaggcctc       540
     tggctgctgc aactggccga ttatttcata tcaattctcc tctcctttgc cgccggagct       600
     atgacttaca ttgtttttgc taagctcttc ccggaatcat tcaatcagca ccgcaggctc       660
     gctctcacag gcggtttttg cggcatgctt ttcttcttat tgctttcctt attagaataa       720
//

If you have problems or comments...

PBIL Back to PBIL home page